IPO11 (importin 11)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 51194
• Gene name: Importin 11
• Gene symbol: IPO11
• Synonyms (NCBI Gene): RanBP11
• Chromosome: 5
• Chromosome location: 5q12.1
• Summary: Importins, including IPO11, are a members of the karyopherin/importin-beta family of transport receptors (see KPNB1; 602738) that mediate nucleocytoplasmic transport of protein and RNA cargoes (Plafker and Macara, 2000 [PubMed 11032817]).[supplied by OMIM

miRNA Show/Hide all (96)

miRTarBase ID	miRNA	Experiments	Reference
MIRT032019	hsa-miR-16-5p	Proteomics	18668040
MIRT052306	hsa-let-7b-5p	CLASH	23622248
MIRT662152	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT662151	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT662149	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT662150	hsa-miR-3119	HITS-CLIP	23824327
MIRT662148	hsa-miR-4279	HITS-CLIP	23824327
MIRT662147	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT662146	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT662152	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT662151	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT662149	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT662150	hsa-miR-3119	HITS-CLIP	23824327
MIRT662148	hsa-miR-4279	HITS-CLIP	23824327
MIRT662147	hsa-miR-3679-3p	HITS-CLIP	23824327
MIRT662146	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT1068704	hsa-miR-105	CLIP-seq
MIRT1068705	hsa-miR-10a	CLIP-seq
MIRT1068706	hsa-miR-10b	CLIP-seq
MIRT1068707	hsa-miR-1224-5p	CLIP-seq
MIRT1068708	hsa-miR-1287	CLIP-seq
MIRT1068709	hsa-miR-1304	CLIP-seq
MIRT1068710	hsa-miR-21	CLIP-seq
MIRT1068711	hsa-miR-296-5p	CLIP-seq
MIRT1068712	hsa-miR-3135b	CLIP-seq
MIRT1068713	hsa-miR-3179	CLIP-seq
MIRT1068714	hsa-miR-3591-5p	CLIP-seq
MIRT1068715	hsa-miR-3606	CLIP-seq
MIRT1068716	hsa-miR-3915	CLIP-seq
MIRT1068717	hsa-miR-3928	CLIP-seq
MIRT1068718	hsa-miR-4292	CLIP-seq
MIRT1068719	hsa-miR-4313	CLIP-seq
MIRT1068720	hsa-miR-4450	CLIP-seq
MIRT1068721	hsa-miR-4464	CLIP-seq
MIRT1068722	hsa-miR-4666-5p	CLIP-seq
MIRT1068723	hsa-miR-4667-5p	CLIP-seq
MIRT1068724	hsa-miR-4689	CLIP-seq
MIRT1068725	hsa-miR-4700-5p	CLIP-seq
MIRT1068726	hsa-miR-4703-3p	CLIP-seq
MIRT1068727	hsa-miR-4748	CLIP-seq
MIRT1068728	hsa-miR-590-5p	CLIP-seq
MIRT1068729	hsa-miR-758	CLIP-seq
MIRT1068730	hsa-miR-921	CLIP-seq
MIRT1068731	hsa-miR-3199	CLIP-seq
MIRT1068732	hsa-miR-4648	CLIP-seq
MIRT1068733	hsa-miR-552	CLIP-seq
MIRT2016710	hsa-miR-520d-5p	CLIP-seq
MIRT2016711	hsa-miR-524-5p	CLIP-seq
MIRT1068704	hsa-miR-105	CLIP-seq
MIRT1068731	hsa-miR-3199	CLIP-seq
MIRT2248800	hsa-miR-342-3p	CLIP-seq
MIRT1068732	hsa-miR-4648	CLIP-seq
MIRT2248801	hsa-miR-4659a-3p	CLIP-seq
MIRT2248802	hsa-miR-4659b-3p	CLIP-seq
MIRT2016710	hsa-miR-520d-5p	CLIP-seq
MIRT2016711	hsa-miR-524-5p	CLIP-seq
MIRT2248803	hsa-miR-616	CLIP-seq
MIRT2248804	hsa-miR-646	CLIP-seq
MIRT1068731	hsa-miR-3199	CLIP-seq
MIRT1068732	hsa-miR-4648	CLIP-seq
MIRT1068733	hsa-miR-552	CLIP-seq
MIRT2552540	hsa-miR-1178	CLIP-seq
MIRT2552541	hsa-miR-1250	CLIP-seq
MIRT2552542	hsa-miR-3192	CLIP-seq
MIRT1068731	hsa-miR-3199	CLIP-seq
MIRT2552543	hsa-miR-3907	CLIP-seq
MIRT2552544	hsa-miR-4277	CLIP-seq
MIRT2552545	hsa-miR-4433	CLIP-seq
MIRT2552546	hsa-miR-4515	CLIP-seq
MIRT1068732	hsa-miR-4648	CLIP-seq
MIRT2248801	hsa-miR-4659a-3p	CLIP-seq
MIRT2248802	hsa-miR-4659b-3p	CLIP-seq
MIRT2552547	hsa-miR-495	CLIP-seq
MIRT2552548	hsa-miR-513a-5p	CLIP-seq
MIRT1068733	hsa-miR-552	CLIP-seq
MIRT2552549	hsa-miR-802	CLIP-seq
MIRT2552550	hsa-miR-942	CLIP-seq
MIRT2552540	hsa-miR-1178	CLIP-seq
MIRT2552541	hsa-miR-1250	CLIP-seq
MIRT2682873	hsa-miR-3117-3p	CLIP-seq
MIRT2682874	hsa-miR-3169	CLIP-seq
MIRT2552542	hsa-miR-3192	CLIP-seq
MIRT1068731	hsa-miR-3199	CLIP-seq
MIRT2552543	hsa-miR-3907	CLIP-seq
MIRT2552544	hsa-miR-4277	CLIP-seq
MIRT2552545	hsa-miR-4433	CLIP-seq
MIRT2552546	hsa-miR-4515	CLIP-seq
MIRT1068732	hsa-miR-4648	CLIP-seq
MIRT2248801	hsa-miR-4659a-3p	CLIP-seq
MIRT2248802	hsa-miR-4659b-3p	CLIP-seq
MIRT2682875	hsa-miR-4759	CLIP-seq
MIRT2552547	hsa-miR-495	CLIP-seq
MIRT2552548	hsa-miR-513a-5p	CLIP-seq
MIRT1068733	hsa-miR-552	CLIP-seq
MIRT2552549	hsa-miR-802	CLIP-seq
MIRT2552550	hsa-miR-942	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 33961781, 34819669, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006606	Process	Protein import into nucleus	IBA
GO:0006610	Process	Ribosomal protein import into nucleus	IEA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0015031	Process	Protein transport	IEA
GO:0031267	Function	Small GTPase binding	IEA
GO:0061608	Function	Nuclear import signal receptor activity	IEA

Other IDs

• MIM: 610889
• HGNC: 20628
• e!Ensembl: ENSG00000086200

Protein

• UniProt ID: Q9UI26
• Protein name: Importin-11 (Imp11) (Ran-binding protein 11) (RanBP11)
• Protein function: Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) t
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03810	IBN_N	28 → 100	Importin-beta N-terminal domain	Family

• Sequence:

  MDLNSASTVVLQVLTQATSQDTAVLKPAEEQLKQWETQPGFYSVLLNIFTNHTLDINVRW
  LAVLYFKHGIDRYWRRVAPHALSEEEKTTLRAGLITNFNEPINQIATQIAVLIAKVARLD
  CPRQWPELIPTLIESVKVQDDLRQHRALLTFYHVTKTLASKRLAADRKLFYDLASGIYNF
  ACSLWNHHTDTFLQEVSSGNEAAILSSLERTLLSLKVLRKLTVNGFVEPHKNMEVMGFLH
  GIFERLKQFLECSRSIGTDNVCRDRLEKTIILFTKVLLDFLDQHPFSFTPLIQRSLEFSV
  SYVFTEVGEGVTFERFIVQCMNLIKMIVKNYAYKPSKNFEDSSPETLEAHKIKMAFFTYP
  TLTEICRRLVSHYFLLTEEELTMWEEDPEGFTVEETGGDSWKYSLRPCTEVLFIDIFHEY
  NQTLTPVLLEMMQTLQGPTNVEDMNALLIKDAVYNAVGLAAYELFDSVDFDQWFKNQLLP
  ELQVIHNRYKPLRRRVIWLIGQWISVKFKSDLRPMLYEAICNLLQDQDLVVRIETATTLK
  LTVDDFEFRTDQFLPYLETMFTLLFQLLQQVTECDTKMHVLHVLSCVIERVNMQIRPYVG
  CLVQYLPLLWKQSEEHNMLRCAILTTLIHLVQGLGADSKNLYPFLLPVIQLSTDVSQPPH
  VYLLEDGLELWLVTLENSPCITPELLRIFQNMSPLLELSSENLRTCFKIINGYIFLSSTE
  FLQTYAVGLCQSFCELLKEITTEGQVQVLKVVENALKVNPILGPQMFQPILPYVFKGIIE
  GERYPVVMSTYLGVMGRVLLQNTSFFSSLLNEMAHKFNQEMDQLLGNMIEMWVDRMDNIT
  QPERRKLSALALLSLLPSDNSVIQDKFCGIINISVEGLHDVMTEDPETGTYKDCMLMSHL
  EEPKVTEDEEPPTEQDKRKKMLALKDPVHTVSLQQFIYEKLKAQQEMLGEQGFQSLMETV
  DTEIVTQLQEFLQGF

• Sequence length: 975

Pathways

KEGG Pathway:

Nucleocytoplasmic transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (11)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HYDROCEPHALUS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	23509962	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (14)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	26079129	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	26079129		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29602637		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29602637		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31881079	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28736931		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28736931		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	31339356	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	28193700, 28258103		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28258103		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29602637		★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	36883376	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28193699, 28193700, 29602637		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for IPO11.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to IPO11.