INTS4 (integrator complex subunit 4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 92105
• Gene name: Integrator complex subunit 4
• Gene symbol: INTS4
• Synonyms (NCBI Gene): INT4, MST093
• Chromosome: 11
• Chromosome location: 11q14.1
• Summary: INTS4 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690) (Ba

miRNA Show/Hide all (24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020869	hsa-miR-155-5p	Proteomics	18668040
MIRT048141	hsa-miR-197-3p	CLASH	23622248
MIRT037855	hsa-miR-455-3p	CLASH	23622248
MIRT2016593	hsa-miR-3154	CLIP-seq
MIRT2016594	hsa-miR-3653	CLIP-seq
MIRT2016595	hsa-miR-4425	CLIP-seq
MIRT2016596	hsa-miR-452	CLIP-seq
MIRT2016597	hsa-miR-4676-3p	CLIP-seq
MIRT2016598	hsa-miR-4717-5p	CLIP-seq
MIRT2016599	hsa-miR-4747-5p	CLIP-seq
MIRT2016600	hsa-miR-645	CLIP-seq
MIRT2016601	hsa-miR-7	CLIP-seq
MIRT2016593	hsa-miR-3154	CLIP-seq
MIRT2016594	hsa-miR-3653	CLIP-seq
MIRT2016598	hsa-miR-4717-5p	CLIP-seq
MIRT2016600	hsa-miR-645	CLIP-seq
MIRT2016593	hsa-miR-3154	CLIP-seq
MIRT2016594	hsa-miR-3653	CLIP-seq
MIRT2016598	hsa-miR-4717-5p	CLIP-seq
MIRT2016600	hsa-miR-645	CLIP-seq
MIRT2016593	hsa-miR-3154	CLIP-seq
MIRT2016594	hsa-miR-3653	CLIP-seq
MIRT2016598	hsa-miR-4717-5p	CLIP-seq
MIRT2016600	hsa-miR-645	CLIP-seq

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16239144, 25416956, 26871637, 31515488, 32296183, 33548203, 33961781
GO:0005634	Component	Nucleus	IDA	29471365, 39032489, 39032490
GO:0005634	Component	Nucleus	IDA	23904267
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	32647223
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	29471365
GO:0005737	Component	Cytoplasm	IEA
GO:0016180	Process	SnRNA processing	IBA
GO:0016180	Process	SnRNA processing	IDA	16239144
GO:0016180	Process	SnRNA processing	NAS	16239144
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	29471365, 33548203
GO:0032039	Component	Integrator complex	IBA
GO:0032039	Component	Integrator complex	IDA	16239144, 29471365, 33548203, 36920904, 39032489, 39032490
GO:0032039	Component	Integrator complex	NAS	33548203
GO:0034243	Process	Regulation of transcription elongation by RNA polymerase II	NAS	32697989
GO:0160232	Component	INTAC complex	IDA	33243860, 34004147, 34762484, 36869814, 38570683
GO:0160240	Process	RNA polymerase II transcription initiation surveillance	IDA	33243860, 34004147, 38570683

Other IDs

• MIM: 611348
• HGNC: 25048
• e!Ensembl: ENSG00000149262

Protein

• UniProt ID: Q96HW7
• Protein name: Integrator complex subunit 4 (Int4)
• Protein function: Component of the integrator complex, a multiprotein complex that terminates RNA polymerase II (Pol II) transcription in the promoter-proximal region of genes (PubMed:29471365, PubMed:33243860, PubMed:33548203, PubMed:38570683). The integrator co
• PDB: 7BFP , 7BFQ , 7CUN , 7PKS , 7YCX , 8R2D , 8RBX , 8RBZ , 8RC4 , 8YJB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12765	Cohesin_HEAT	178 → 218	HEAT repeat associated with sister chromatid cohesion	Family

• Sequence:

  MAAHLKKRVYEEFTKVVQPQEEIATKKLRLTKPSKSAALHIDLCKATSPADALQYLLQFA
  RKPVEAESVEGVVRILLEHYYKENDPSVRLKIASLLGLLSKTAGFSPDCIMDDAINILQN
  EKSHQVLAQLLDTLLAIGTKLPENQAIQMRLVDVACKHLTDTSHGVRNKCLQLLGNLGSL
  EKSVTKDAEGLAARDVQKIIGDYFSDQDPRVRTAAIKAMLQLHERGLKLHQTIYNQACKL
  LSDDYEQVRSAAVQLIWVVSQLYPESIVPIPSSNEEIRLVDDAFGKICHMVSDGSWVVRV
  QAAKLLGSMEQVSSHFLEQTLDKKLMSDLRRKRTAHERAKELYSSGEFSSGRKWGDDAPK
  EEVDTGAVNLIESGACGAFVHGLEDEMYEVRIAAVEALCMLAQSSPSFAEKCLDFLVDMF
  NDEIEEVRLQSIHTMRKISNNITLREDQLDTVLAVLEDSSRDIREALHELLCCTNVSTKE
  GIHLALVELLKNLTKYPTDRDSIWKCLKFLGSRHPTLVLPLVPELLSTHPFFDTAEPDMD
  DPAYIAVLVLIFNAAKTCPTMPALFSDHTFRHYAYLRDSLSHLVPALRLPGRKLVSSAVS
  PSIIPQEDPSQQFLQQSLERVYSLQHLDPQGAQELLEFTIRDLQRLGELQSELAGVADFS
  ATYLRCQLLLIKALQEKLWNVAAPLYLKQSDLASAAAKQIMEETYKMEFMYSGVENKQVV
  IIHHMRLQAKALQLIVTARTTRGLDPLFGMCEKFLQEVDFFQRYFIADLPHLQDSFVDKL
  LDLMPRLMTSKPAEVVKILQTMLRQSAFLHLPLPEQIHKASATIIEPAGESDNPLRFTSG
  LVVALDVDATLEHVQDPQNTVKVQVLYPDGQAQMIHPKPADFRNPGPGRHRLITQVYLSH
  TAWTEACQVEVRLLLAYNSSARIPKCPWMEGGEMSPQVETSIEGTIPFSKPVKVYIMPKP
  ARR

• Sequence length: 963

Pathways

Reactome Pathway:

RNA polymerase II transcribes snRNA genes

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
OVARIAN CARCINOMA	—	GWAS catalog	28935272	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	28935272	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	37340002, 37945903	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	37340002, 37945903	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	24763052	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (15)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anemia	Anemia	BEFREE	17466092		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	18998137		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30566516		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30566516		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30566516		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30566516		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	27687579		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	16002921		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	24763052		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20405176		★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	12729343		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	24763052		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19055603, 30345642		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	22160516		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	17876529		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for INTS4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to INTS4.