Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	3641
Gene name	Insulin like 4
Gene symbol	INSL4
Synonyms (NCBI Gene)	EPILPLACENTIN
Chromosome	9
Chromosome location	9p24.1
Summary	INSL4 encodes the insulin-like 4 protein, a member of the insulin superfamily. INSL4 encodes a precursor that undergoes post-translational cleavage to produce 3 polypeptide chains, A-C, that form tertiary structures composed of either all three chains, or

19 Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030220	hsa-miR-26b-5p	Microarray	19088304
MIRT532329	hsa-miR-8084	PAR-CLIP	22012620
MIRT532328	hsa-miR-580-5p	PAR-CLIP	22012620
MIRT532327	hsa-miR-494-3p	PAR-CLIP	22012620
MIRT532326	hsa-miR-1257	PAR-CLIP	22012620
MIRT443739	hsa-miR-16-1-3p	PAR-CLIP	22100165
MIRT443738	hsa-miR-1227-3p	PAR-CLIP	22100165
MIRT443737	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT443736	hsa-miR-550b-2-5p	PAR-CLIP	22100165
MIRT443735	hsa-miR-2113	PAR-CLIP	22100165
MIRT532329	hsa-miR-8084	PAR-CLIP	22012620
MIRT532328	hsa-miR-580-5p	PAR-CLIP	22012620
MIRT532327	hsa-miR-494-3p	PAR-CLIP	22012620
MIRT532326	hsa-miR-1257	PAR-CLIP	22012620
MIRT443739	hsa-miR-16-1-3p	PAR-CLIP	22100165
MIRT443738	hsa-miR-1227-3p	PAR-CLIP	22100165
MIRT443737	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT443736	hsa-miR-550b-2-5p	PAR-CLIP	22100165
MIRT443735	hsa-miR-2113	PAR-CLIP	22100165

8 Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	TAS	8702754
GO:0005159	Function	Insulin-like growth factor receptor binding	TAS	8666396
GO:0005179	Function	Hormone activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	TAS	8702754
GO:0007165	Process	Signal transduction	IEA
GO:0007267	Process	Cell-cell signaling	TAS	8702754
GO:1901384	Process	Positive regulation of chorionic trophoblast cell proliferation	TAS	8702754

MIM	HGNC	e!Ensembl
600910	6087	ENSG00000120211

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q14641
Protein name	Early placenta insulin-like peptide (EPIL) (Insulin-like peptide 4) (Placentin) [Cleaved into: Early placenta insulin-like peptide B chain; Early placenta insulin-like peptide A chain]
Protein function	May play an important role in trophoblast development and in the regulation of bone formation.
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Expressed in placenta, uterus and in fetal perichondrium. Expression levels were increased in both early placentas and molar pregnancies and were reduced in choriocarcinoma cells. {ECO:0000269\|PubMed:12414911, ECO:0000269\|PubMed:974031
Sequence	MASLFRSYLPAIWLLLSQLLRESLAAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLE SGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRF DPFCCEVICDDGTSVKLCT
Sequence length	139
Interactions	View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CLONAL HEMATOPOIESIS	—	GWAS catalog	32518416	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	39792054	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	19915573, 26398853	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (12)
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30423141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30423141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	12414911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	11061561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30423141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30423141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18035692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30423141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis, Type 3, mixed central and peripheral	Neurofibromatosis	BEFREE	26430762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30423141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36326314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	9730618		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with INSL4 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for INSL4.

Diseases Linked via Similar Genes Diseases curated for genes most similar to INSL4 (see Related Genes above), that are NOT already directly curated for INSL4 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to INSL4.

INSL4 (insulin like 4)

Bookmark This Gene