INKA1 (inka box actin regulator 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 389119
Gene name Inka box actin regulator 1
Gene symbol INKA1
Synonyms (NCBI Gene)
C3orf54FAM212AINCA
Chromosome 3
Chromosome location 3p21.31
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183, 32814053, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 26607847
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IDA 26607847
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620426 32480 ENSG00000185614
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96EL1
Protein name PAK4-inhibitor INKA1 (Induced in neural crest by AP2-alpha protein homolog) (Inca) (Inka-box actin regulator 1)
Protein function Inhibitor of the serine/threonine-protein kinase PAK4 (PubMed:26607847). Acts by binding PAK4 in a substrate-like manner, inhibiting the protein kinase activity (PubMed:26607847).
PDB 4XBR , 4XBU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15342 FAM212 151 → 206 FAM212 family Family
Sequence 
MDMHSARLDSFLSQLRWELLCGRDTGSPSMPGPLQPTSQTGPDVQPSHQLRASGALEEDS
VCCVEEEEEEEEEAVVTEDRDAALGGPREHALDWDSGFSEVSGSTWREEELPVSQRPAPS
AQPLRRQCLSVSGLPMPSRAPVASVPPVHHPRPKSTPDACLEHWQGLEAEDWTAALLNRG
RSRQPLVLGDNCFADLVHNWMELPETGSEGGDGGGHRARARPPQFLLGLSEQLRRRLARA
RRTAMAGKRLSCPPRPEPELPADVSRFAALMSCRSRQPIICNDVSYL
Sequence length 287
Interactions View interactions

No strongly related genes found yet for INKA1.

No additional diseases found yet through genes similar to INKA1.