INE1 (inactivation escape 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 8552 |
| Gene name | Inactivation escape 1 |
| Gene symbol | INE1 |
| Synonyms (NCBI Gene) |
NCRNA00010
|
| Chromosome | X |
| Chromosome location | Xp11.3 |
| Summary | X chromosome inactivation provides dosage compensation for the expression level of X-linked genes from the single X in males and the two in females. This X chromosome gene is intronless and was identified because its transcription escapes X inactivation i |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
O15225 |
| Protein name | Putative inactivation escape 1 protein |
| Family and domains | |
| Tissue specificity | TISSUE SPECIFICITY: Highly expressed in pancreas, heart and liver followed by brain, placenta, lung, skeletal muscle and kidney. Mostly expressed in females. {ECO:0000269|PubMed:9244435}. |
| Sequence |
MSGPLSPVCSCPQLPFMLSPCHMHHHPGHVALSQTVSPASLLTQGLGLPQH |
| Sequence length | 51 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with INE1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to INE1 (see Related Genes above), that are NOT already directly curated for INE1 itself -- a lead worth checking, not a confirmed association.
0
|
|