Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	9466
Gene name	Interleukin 27 receptor subunit alpha
Gene symbol	IL27RA
Synonyms (NCBI Gene)	CRL1IL-27RAIL27RTCCRWSX1zcytor1
Chromosome	19
Chromosome location	19p13.12
Summary	In mice, CD4+ helper T-cells differentiate into type 1 (Th1) cells, which are critical for cell-mediated immunity, predominantly under the influence of IL12. Also, IL4 influences their differentiation into type 2 (Th2) cells, which are critical for most a

76 Show/Hide all (76)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022747	hsa-miR-124-3p	Microarray	18668037
MIRT023830	hsa-miR-1-3p	Microarray	18668037
MIRT1064692	hsa-miR-122	CLIP-seq
MIRT1064693	hsa-miR-1254	CLIP-seq
MIRT1064694	hsa-miR-140-5p	CLIP-seq
MIRT1064695	hsa-miR-142-3p	CLIP-seq
MIRT1064696	hsa-miR-1912	CLIP-seq
MIRT1064697	hsa-miR-193a-5p	CLIP-seq
MIRT1064698	hsa-miR-3116	CLIP-seq
MIRT1064699	hsa-miR-3127-5p	CLIP-seq
MIRT1064700	hsa-miR-3130-5p	CLIP-seq
MIRT1064701	hsa-miR-3174	CLIP-seq
MIRT1064702	hsa-miR-3184	CLIP-seq
MIRT1064703	hsa-miR-3545-5p	CLIP-seq
MIRT1064704	hsa-miR-3674	CLIP-seq
MIRT1064705	hsa-miR-423-5p	CLIP-seq
MIRT1064706	hsa-miR-4254	CLIP-seq
MIRT1064707	hsa-miR-4257	CLIP-seq
MIRT1064708	hsa-miR-4270	CLIP-seq
MIRT1064709	hsa-miR-431	CLIP-seq
MIRT1064710	hsa-miR-4441	CLIP-seq
MIRT1064711	hsa-miR-4460	CLIP-seq
MIRT1064712	hsa-miR-4482	CLIP-seq
MIRT1064713	hsa-miR-4727-3p	CLIP-seq
MIRT1064714	hsa-miR-921	CLIP-seq
MIRT1064692	hsa-miR-122	CLIP-seq
MIRT1064693	hsa-miR-1254	CLIP-seq
MIRT1064696	hsa-miR-1912	CLIP-seq
MIRT1064698	hsa-miR-3116	CLIP-seq
MIRT2015393	hsa-miR-3127-3p	CLIP-seq
MIRT1064700	hsa-miR-3130-5p	CLIP-seq
MIRT2015394	hsa-miR-3189-3p	CLIP-seq
MIRT2015395	hsa-miR-335	CLIP-seq
MIRT2015396	hsa-miR-3943	CLIP-seq
MIRT1064706	hsa-miR-4254	CLIP-seq
MIRT2015397	hsa-miR-4302	CLIP-seq
MIRT1064712	hsa-miR-4482	CLIP-seq
MIRT2015398	hsa-miR-4505	CLIP-seq
MIRT2015399	hsa-miR-4652-3p	CLIP-seq
MIRT2015400	hsa-miR-4711-3p	CLIP-seq
MIRT2015401	hsa-miR-4721	CLIP-seq
MIRT2015402	hsa-miR-4778-5p	CLIP-seq
MIRT2015403	hsa-miR-578	CLIP-seq
MIRT2015404	hsa-miR-579	CLIP-seq
MIRT1064692	hsa-miR-122	CLIP-seq
MIRT2247682	hsa-miR-1224-3p	CLIP-seq
MIRT1064693	hsa-miR-1254	CLIP-seq
MIRT2247683	hsa-miR-150	CLIP-seq
MIRT1064696	hsa-miR-1912	CLIP-seq
MIRT1064698	hsa-miR-3116	CLIP-seq
MIRT1064700	hsa-miR-3130-5p	CLIP-seq
MIRT1064706	hsa-miR-4254	CLIP-seq
MIRT1064707	hsa-miR-4257	CLIP-seq
MIRT1064712	hsa-miR-4482	CLIP-seq
MIRT1064692	hsa-miR-122	CLIP-seq
MIRT1064693	hsa-miR-1254	CLIP-seq
MIRT1064696	hsa-miR-1912	CLIP-seq
MIRT1064697	hsa-miR-193a-5p	CLIP-seq
MIRT1064698	hsa-miR-3116	CLIP-seq
MIRT1064700	hsa-miR-3130-5p	CLIP-seq
MIRT1064702	hsa-miR-3184	CLIP-seq
MIRT2389373	hsa-miR-3663-5p	CLIP-seq
MIRT2389374	hsa-miR-371-5p	CLIP-seq
MIRT2389375	hsa-miR-371b-5p	CLIP-seq
MIRT1064705	hsa-miR-423-5p	CLIP-seq
MIRT1064706	hsa-miR-4254	CLIP-seq
MIRT1064709	hsa-miR-431	CLIP-seq
MIRT1064712	hsa-miR-4482	CLIP-seq
MIRT2015399	hsa-miR-4652-3p	CLIP-seq
MIRT1064707	hsa-miR-4257	CLIP-seq
MIRT2551230	hsa-miR-1227	CLIP-seq
MIRT2551231	hsa-miR-3650	CLIP-seq
MIRT2551232	hsa-miR-3934	CLIP-seq
MIRT2551233	hsa-miR-552	CLIP-seq
MIRT2551230	hsa-miR-1227	CLIP-seq
MIRT2551231	hsa-miR-3650	CLIP-seq

25 Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002692	Process	Negative regulation of cellular extravasation	IEA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IEA
GO:0002829	Process	Negative regulation of type 2 immune response	IBA
GO:0002829	Process	Negative regulation of type 2 immune response	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	9600072
GO:0005515	Function	Protein binding	IPI	19386761, 32296183
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9600072
GO:0006955	Process	Immune response	TAS	9600072
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9600072
GO:0016020	Component	Membrane	IEA
GO:0032700	Process	Negative regulation of interleukin-17 production	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IMP	19386761
GO:0045509	Function	Interleukin-27 receptor activity	IBA
GO:0045509	Function	Interleukin-27 receptor activity	IEA
GO:0048302	Process	Regulation of isotype switching to IgG isotypes	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0070106	Process	Interleukin-27-mediated signaling pathway	IEA
GO:2000317	Process	Negative regulation of T-helper 17 type immune response	IEA
GO:2000408	Process	Negative regulation of T cell extravasation	IEA

MIM	HGNC	e!Ensembl
605350	17290	ENSG00000104998

Q6UWB1

Protein name

Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Cytokine receptor WSX-1) (Cytokine receptor-like 1) (Type I T-cell cytokine receptor) (TCCR) (ZcytoR1)

Protein function

Receptor for IL27. Requires IL6ST/GP130 to mediate signal transduction in response to IL27. This signaling system acts through STAT3 and STAT1. Acts as a receptor for the neuroprotective peptide humanin as part of a complex with IL6ST/GP130 and

PDB

7T5M , 7U7N , 8D85

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00041	fn3	321 → 406	Fibronectin type III domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in lymphoid tissues such as spleen, lymph nodes and peripheral blood leukocytes. Weakly expressed in other tissues examined including heart, brain, fetal and adult lung, liver, skeletal muscle, kidney, pancreas, prosta

Sequence

MRGGRGAPFWLWPLPKLALLPLLWVLFQRTRPQGSAGPLQCYGVGPLGDLNCSWEPLGDL
GAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFV
NLETQMKPNAPRLGPDVDFSEDDPLEATVHWAPPTWPSHKVLICQFHYRRCQEAAWTLLE
PELKTIPLTPVEIQDLELATGYKVYGRCRMEKEEDLWGEWSPILSFQTPPSAPKDVWVSG
NLCGTPGGEEPLLLWKAPGPCVQVSYKVWFWVGGRELSPEGITCCCSLIPSGAEWARVSA
VNATSWEPLTNLSLVCLDSASAPRSVAVSSIAGSTELLVTWQPGPGEPLEHVVDWARDGD
PLEKLNWVRLPPGNLSALLPGNFTVGVPYRITVTAVSASGLASASSVWGFREELAPLVGP
TLWRLQDAPPGTPAIAWGEVPRHQLRGHLTHYTLCAQSGTSPSVCMNVSGNTQSVTLPDL
PWGPCELWVTASTIAGQGPPGPILRLHLPDNTLRWKVLPGILFLWGLFLLGCGLSLATSG
RCYHLRHKVLPRWVWEKVPDPANSSSGQPHMEQVPEAQPLGDLPILEVEEMEPPPVMESS
QPAQATAPLDSGYEKHFLPTPEELGLLGPPRPQVLA

Sequence length

636

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Cytokine-cytokine receptor interaction	Interleukin-35 Signalling
JAK-STAT signaling pathway	Interleukin-27 signaling
Th17 cell differentiation

IL27RA (interleukin 27 receptor subunit alpha)

Bookmark This Gene