IL17RA (interleukin 17 receptor A)

Gene

• Entrez ID: 23765
• Gene name: Interleukin 17 receptor A
• Gene symbol: IL17RA
• Synonyms (NCBI Gene): CANDF5, CD217, CDw217, IL-17RA, IL17R, IMD51, hIL-17R
• Chromosome: 22
• Chromosome location: 22q11.1
• Summary: Interleukin 17A (IL17A) is a proinflammatory cytokine secreted by activated T-lymphocytes. It is a potent inducer of the maturation of CD34-positive hematopoietic precursors into neutrophils. The transmembrane protein encoded by this gene (interleukin 17A

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs201128237	T>C	Likely-pathogenic	Splice donor variant
rs387906913	C>T	Pathogenic	Stop gained, coding sequence variant
rs778624945	C>A,T	Pathogenic	Synonymous variant, coding sequence variant, stop gained
rs1057518744	->GGAGATGGTGGAGAGCA	Pathogenic	Frameshift variant, coding sequence variant
rs1057518745	C>G,T	Pathogenic	Coding sequence variant, stop gained, missense variant
rs1057518746	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs1057518747	CCAGA>-	Pathogenic	Frameshift variant, coding sequence variant
rs1057519079	G>A	Pathogenic	Coding sequence variant, missense variant
rs1601340933	->ACCT	Pathogenic	Coding sequence variant, frameshift variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019991	hsa-miR-375	Microarray	20215506
MIRT049271	hsa-miR-92a-3p	CLASH	23622248
MIRT631783	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT631782	hsa-miR-10b-3p	HITS-CLIP	23824327
MIRT631781	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT631780	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT631779	hsa-miR-4279	HITS-CLIP	23824327
MIRT631778	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT631777	hsa-miR-498	HITS-CLIP	23824327
MIRT450060	hsa-miR-4426	PAR-CLIP	22100165
MIRT450059	hsa-miR-4647	PAR-CLIP	22100165
MIRT450058	hsa-miR-4662b	PAR-CLIP	22100165
MIRT450057	hsa-miR-135a-5p	PAR-CLIP	22100165
MIRT450056	hsa-miR-135b-5p	PAR-CLIP	22100165
MIRT450055	hsa-miR-7162-3p	PAR-CLIP	22100165
MIRT450054	hsa-miR-2114-3p	PAR-CLIP	22100165
MIRT450053	hsa-miR-6823-3p	PAR-CLIP	22100165
MIRT450051	hsa-miR-7854-3p	PAR-CLIP	22100165
MIRT450052	hsa-miR-6134	PAR-CLIP	22100165
MIRT450050	hsa-miR-7160-5p	PAR-CLIP	22100165
MIRT450049	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT450048	hsa-miR-3978	PAR-CLIP	22100165
MIRT631783	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT631782	hsa-miR-10b-3p	HITS-CLIP	23824327
MIRT631781	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT631780	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT631779	hsa-miR-4279	HITS-CLIP	23824327
MIRT631778	hsa-miR-5001-3p	HITS-CLIP	23824327
MIRT631777	hsa-miR-498	HITS-CLIP	23824327
MIRT450060	hsa-miR-4426	PAR-CLIP	22100165
MIRT450059	hsa-miR-4647	PAR-CLIP	22100165
MIRT450058	hsa-miR-4662b	PAR-CLIP	22100165
MIRT450057	hsa-miR-135a-5p	PAR-CLIP	22100165
MIRT450056	hsa-miR-135b-5p	PAR-CLIP	22100165
MIRT450055	hsa-miR-7162-3p	PAR-CLIP	22100165
MIRT450054	hsa-miR-2114-3p	PAR-CLIP	22100165
MIRT450053	hsa-miR-6823-3p	PAR-CLIP	22100165
MIRT450051	hsa-miR-7854-3p	PAR-CLIP	22100165
MIRT450052	hsa-miR-6134	PAR-CLIP	22100165
MIRT450050	hsa-miR-7160-5p	PAR-CLIP	22100165
MIRT450049	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT450048	hsa-miR-3978	PAR-CLIP	22100165
MIRT1063819	hsa-miR-1200	CLIP-seq
MIRT1063820	hsa-miR-1227	CLIP-seq
MIRT1063821	hsa-miR-124	CLIP-seq
MIRT1063822	hsa-miR-1254	CLIP-seq
MIRT1063823	hsa-miR-1255a	CLIP-seq
MIRT1063824	hsa-miR-1255b	CLIP-seq
MIRT1063825	hsa-miR-1270	CLIP-seq
MIRT1063826	hsa-miR-1273f	CLIP-seq
MIRT1063827	hsa-miR-1275	CLIP-seq
MIRT1063828	hsa-miR-1283	CLIP-seq
MIRT1063829	hsa-miR-1287	CLIP-seq
MIRT1063830	hsa-miR-1290	CLIP-seq
MIRT1063831	hsa-miR-1291	CLIP-seq
MIRT1063832	hsa-miR-129-5p	CLIP-seq
MIRT1063833	hsa-miR-1303	CLIP-seq
MIRT1063834	hsa-miR-139-3p	CLIP-seq
MIRT1063835	hsa-miR-146b-3p	CLIP-seq
MIRT1063836	hsa-miR-149	CLIP-seq
MIRT1063837	hsa-miR-150	CLIP-seq
MIRT1063838	hsa-miR-1909	CLIP-seq
MIRT1063839	hsa-miR-1913	CLIP-seq
MIRT1063840	hsa-miR-194	CLIP-seq
MIRT1063841	hsa-miR-197	CLIP-seq
MIRT1063842	hsa-miR-1976	CLIP-seq
MIRT1063843	hsa-miR-217	CLIP-seq
MIRT1063844	hsa-miR-22	CLIP-seq
MIRT1063845	hsa-miR-24	CLIP-seq
MIRT1063846	hsa-miR-298	CLIP-seq
MIRT1063847	hsa-miR-3074-5p	CLIP-seq
MIRT1063848	hsa-miR-3116	CLIP-seq
MIRT1063849	hsa-miR-3117-3p	CLIP-seq
MIRT1063850	hsa-miR-3122	CLIP-seq
MIRT1063851	hsa-miR-3136-5p	CLIP-seq
MIRT1063852	hsa-miR-3140-3p	CLIP-seq
MIRT1063853	hsa-miR-3157-5p	CLIP-seq
MIRT1063854	hsa-miR-3158-3p	CLIP-seq
MIRT1063855	hsa-miR-3167	CLIP-seq
MIRT1063856	hsa-miR-3169	CLIP-seq
MIRT1063857	hsa-miR-3170	CLIP-seq
MIRT1063858	hsa-miR-3173-5p	CLIP-seq
MIRT1063859	hsa-miR-3187-3p	CLIP-seq
MIRT1063860	hsa-miR-3189-5p	CLIP-seq
MIRT1063861	hsa-miR-3194-3p	CLIP-seq
MIRT1063862	hsa-miR-3197	CLIP-seq
MIRT1063863	hsa-miR-324-3p	CLIP-seq
MIRT1063864	hsa-miR-3545-3p	CLIP-seq
MIRT1063865	hsa-miR-3605-5p	CLIP-seq
MIRT1063866	hsa-miR-365	CLIP-seq
MIRT1063867	hsa-miR-3652	CLIP-seq
MIRT1063868	hsa-miR-3656	CLIP-seq
MIRT1063869	hsa-miR-3667-3p	CLIP-seq
MIRT1063870	hsa-miR-3670	CLIP-seq
MIRT1063871	hsa-miR-3681	CLIP-seq
MIRT1063872	hsa-miR-3689a-3p	CLIP-seq
MIRT1063873	hsa-miR-3689c	CLIP-seq
MIRT1063874	hsa-miR-3690	CLIP-seq
MIRT1063875	hsa-miR-3714	CLIP-seq
MIRT1063876	hsa-miR-371-5p	CLIP-seq
MIRT1063877	hsa-miR-3910	CLIP-seq
MIRT1063878	hsa-miR-3913-5p	CLIP-seq
MIRT1063879	hsa-miR-3936	CLIP-seq
MIRT1063880	hsa-miR-4254	CLIP-seq
MIRT1063881	hsa-miR-4258	CLIP-seq
MIRT1063882	hsa-miR-4260	CLIP-seq
MIRT1063883	hsa-miR-4282	CLIP-seq
MIRT1063884	hsa-miR-4284	CLIP-seq
MIRT1063885	hsa-miR-4308	CLIP-seq
MIRT1063886	hsa-miR-4324	CLIP-seq
MIRT1063887	hsa-miR-4430	CLIP-seq
MIRT1063888	hsa-miR-4432	CLIP-seq
MIRT1063889	hsa-miR-4435	CLIP-seq
MIRT1063890	hsa-miR-4438	CLIP-seq
MIRT1063891	hsa-miR-4439	CLIP-seq
MIRT1063892	hsa-miR-4460	CLIP-seq
MIRT1063893	hsa-miR-4480	CLIP-seq
MIRT1063894	hsa-miR-4492	CLIP-seq
MIRT1063895	hsa-miR-4494	CLIP-seq
MIRT1063896	hsa-miR-4498	CLIP-seq
MIRT1063897	hsa-miR-4499	CLIP-seq
MIRT1063898	hsa-miR-4513	CLIP-seq
MIRT1063899	hsa-miR-4521	CLIP-seq
MIRT1063900	hsa-miR-4539	CLIP-seq
MIRT1063901	hsa-miR-455-5p	CLIP-seq
MIRT1063902	hsa-miR-4638-3p	CLIP-seq
MIRT1063903	hsa-miR-4665-5p	CLIP-seq
MIRT1063904	hsa-miR-4683	CLIP-seq
MIRT1063905	hsa-miR-4690-5p	CLIP-seq
MIRT1063906	hsa-miR-4691-3p	CLIP-seq
MIRT1063907	hsa-miR-4701-5p	CLIP-seq
MIRT1063908	hsa-miR-4707-3p	CLIP-seq
MIRT1063909	hsa-miR-4715-3p	CLIP-seq
MIRT1063910	hsa-miR-4716-5p	CLIP-seq
MIRT1063911	hsa-miR-4722-3p	CLIP-seq
MIRT1063912	hsa-miR-4727-3p	CLIP-seq
MIRT1063913	hsa-miR-4728-5p	CLIP-seq
MIRT1063914	hsa-miR-4755-3p	CLIP-seq
MIRT1063915	hsa-miR-4758-3p	CLIP-seq
MIRT1063916	hsa-miR-4759	CLIP-seq
MIRT1063917	hsa-miR-4768-3p	CLIP-seq
MIRT1063918	hsa-miR-4773	CLIP-seq
MIRT1063919	hsa-miR-4781-3p	CLIP-seq
MIRT1063920	hsa-miR-499-5p	CLIP-seq
MIRT1063921	hsa-miR-499a-5p	CLIP-seq
MIRT1063922	hsa-miR-506	CLIP-seq
MIRT1063923	hsa-miR-5095	CLIP-seq
MIRT1063924	hsa-miR-5096	CLIP-seq
MIRT1063925	hsa-miR-512-5p	CLIP-seq
MIRT1063926	hsa-miR-544b	CLIP-seq
MIRT1063927	hsa-miR-548s	CLIP-seq
MIRT1063928	hsa-miR-562	CLIP-seq
MIRT1063929	hsa-miR-578	CLIP-seq
MIRT1063930	hsa-miR-588	CLIP-seq
MIRT1063931	hsa-miR-604	CLIP-seq
MIRT1063932	hsa-miR-618	CLIP-seq
MIRT1063933	hsa-miR-620	CLIP-seq
MIRT1063934	hsa-miR-647	CLIP-seq
MIRT1063935	hsa-miR-762	CLIP-seq
MIRT1063936	hsa-miR-874	CLIP-seq
MIRT1063937	hsa-miR-876-5p	CLIP-seq
MIRT1063938	hsa-miR-943	CLIP-seq
MIRT2015122	hsa-miR-1205	CLIP-seq
MIRT1063823	hsa-miR-1255a	CLIP-seq
MIRT1063824	hsa-miR-1255b	CLIP-seq
MIRT2015123	hsa-miR-1263	CLIP-seq
MIRT1063829	hsa-miR-1287	CLIP-seq
MIRT2015124	hsa-miR-130a	CLIP-seq
MIRT2015125	hsa-miR-130b	CLIP-seq
MIRT2015126	hsa-miR-136	CLIP-seq
MIRT2015127	hsa-miR-148a	CLIP-seq
MIRT2015128	hsa-miR-148b	CLIP-seq
MIRT2015129	hsa-miR-152	CLIP-seq
MIRT2015130	hsa-miR-1587	CLIP-seq
MIRT2015131	hsa-miR-1827	CLIP-seq
MIRT2015132	hsa-miR-183	CLIP-seq
MIRT2015133	hsa-miR-199a-5p	CLIP-seq
MIRT2015134	hsa-miR-199b-5p	CLIP-seq
MIRT2015135	hsa-miR-205	CLIP-seq
MIRT2015136	hsa-miR-2116	CLIP-seq
MIRT2015137	hsa-miR-2467-3p	CLIP-seq
MIRT2015138	hsa-miR-301a	CLIP-seq
MIRT2015139	hsa-miR-301b	CLIP-seq
MIRT2015140	hsa-miR-3120-3p	CLIP-seq
MIRT1063850	hsa-miR-3122	CLIP-seq
MIRT2015141	hsa-miR-3127-5p	CLIP-seq
MIRT2015142	hsa-miR-3130-3p	CLIP-seq
MIRT2015143	hsa-miR-3135	CLIP-seq
MIRT2015144	hsa-miR-3157-3p	CLIP-seq
MIRT2015145	hsa-miR-3160-5p	CLIP-seq
MIRT2015146	hsa-miR-3183	CLIP-seq
MIRT2015147	hsa-miR-3185	CLIP-seq
MIRT2015148	hsa-miR-320a	CLIP-seq
MIRT2015149	hsa-miR-320b	CLIP-seq
MIRT2015150	hsa-miR-320c	CLIP-seq
MIRT2015151	hsa-miR-320d	CLIP-seq
MIRT2015152	hsa-miR-320e	CLIP-seq
MIRT2015153	hsa-miR-330-3p	CLIP-seq
MIRT2015154	hsa-miR-342-5p	CLIP-seq
MIRT2015155	hsa-miR-3591-3p	CLIP-seq
MIRT1063865	hsa-miR-3605-5p	CLIP-seq
MIRT1063867	hsa-miR-3652	CLIP-seq
MIRT2015156	hsa-miR-3661	CLIP-seq
MIRT2015157	hsa-miR-3666	CLIP-seq
MIRT2015158	hsa-miR-3678-3p	CLIP-seq
MIRT1063872	hsa-miR-3689a-3p	CLIP-seq
MIRT1063873	hsa-miR-3689c	CLIP-seq
MIRT1063876	hsa-miR-371-5p	CLIP-seq
MIRT2015159	hsa-miR-371b-5p	CLIP-seq
MIRT2015160	hsa-miR-378g	CLIP-seq
MIRT1063878	hsa-miR-3913-5p	CLIP-seq
MIRT2015161	hsa-miR-3918	CLIP-seq
MIRT2015162	hsa-miR-3942-3p	CLIP-seq
MIRT2015163	hsa-miR-3973	CLIP-seq
MIRT2015164	hsa-miR-4295	CLIP-seq
MIRT2015165	hsa-miR-4302	CLIP-seq
MIRT2015166	hsa-miR-4418	CLIP-seq
MIRT2015167	hsa-miR-4429	CLIP-seq
MIRT1063887	hsa-miR-4430	CLIP-seq
MIRT2015168	hsa-miR-4436a	CLIP-seq
MIRT1063890	hsa-miR-4438	CLIP-seq
MIRT2015169	hsa-miR-4446-3p	CLIP-seq
MIRT1063894	hsa-miR-4492	CLIP-seq
MIRT1063896	hsa-miR-4498	CLIP-seq
MIRT2015170	hsa-miR-4505	CLIP-seq
MIRT2015171	hsa-miR-450b-3p	CLIP-seq
MIRT2015172	hsa-miR-454	CLIP-seq
MIRT2015173	hsa-miR-4633-5p	CLIP-seq
MIRT2015174	hsa-miR-4645-5p	CLIP-seq
MIRT2015175	hsa-miR-4656	CLIP-seq
MIRT2015176	hsa-miR-4664-5p	CLIP-seq
MIRT2015177	hsa-miR-4673	CLIP-seq
MIRT2015178	hsa-miR-4675	CLIP-seq
MIRT2015179	hsa-miR-4677-5p	CLIP-seq
MIRT2015180	hsa-miR-4684-5p	CLIP-seq
MIRT2015181	hsa-miR-4713-3p	CLIP-seq
MIRT2015182	hsa-miR-4723-3p	CLIP-seq
MIRT2015183	hsa-miR-4725-5p	CLIP-seq
MIRT1063913	hsa-miR-4728-5p	CLIP-seq
MIRT2015184	hsa-miR-4731-5p	CLIP-seq
MIRT2015185	hsa-miR-4732-3p	CLIP-seq
MIRT2015186	hsa-miR-4741	CLIP-seq
MIRT2015187	hsa-miR-4756-3p	CLIP-seq
MIRT2015188	hsa-miR-4768-5p	CLIP-seq
MIRT2015189	hsa-miR-4775	CLIP-seq
MIRT2015190	hsa-miR-4786-3p	CLIP-seq
MIRT2015191	hsa-miR-500a	CLIP-seq
MIRT2015192	hsa-miR-504	CLIP-seq
MIRT2015193	hsa-miR-509-3-5p	CLIP-seq
MIRT1063923	hsa-miR-5095	CLIP-seq
MIRT2015194	hsa-miR-509-5p	CLIP-seq
MIRT2015195	hsa-miR-510	CLIP-seq
MIRT1063925	hsa-miR-512-5p	CLIP-seq
MIRT2015196	hsa-miR-520g	CLIP-seq
MIRT2015197	hsa-miR-520h	CLIP-seq
MIRT2015198	hsa-miR-545	CLIP-seq
MIRT1063928	hsa-miR-562	CLIP-seq
MIRT2015199	hsa-miR-590-3p	CLIP-seq
MIRT2015200	hsa-miR-631	CLIP-seq
MIRT2015201	hsa-miR-638	CLIP-seq
MIRT2015202	hsa-miR-648	CLIP-seq
MIRT2015203	hsa-miR-661	CLIP-seq
MIRT1063935	hsa-miR-762	CLIP-seq
MIRT2015204	hsa-miR-769-3p	CLIP-seq
MIRT2015205	hsa-miR-942	CLIP-seq
MIRT2247410	hsa-miR-1245	CLIP-seq
MIRT1063822	hsa-miR-1254	CLIP-seq
MIRT2247411	hsa-miR-1293	CLIP-seq
MIRT2247412	hsa-miR-135a	CLIP-seq
MIRT2247413	hsa-miR-135b	CLIP-seq
MIRT2247414	hsa-miR-139-5p	CLIP-seq
MIRT1063837	hsa-miR-150	CLIP-seq
MIRT2015130	hsa-miR-1587	CLIP-seq
MIRT2247415	hsa-miR-188-3p	CLIP-seq
MIRT2247416	hsa-miR-1972	CLIP-seq
MIRT1063842	hsa-miR-1976	CLIP-seq
MIRT2247417	hsa-miR-2115	CLIP-seq
MIRT1063843	hsa-miR-217	CLIP-seq
MIRT1063845	hsa-miR-24	CLIP-seq
MIRT2247418	hsa-miR-25	CLIP-seq
MIRT1063848	hsa-miR-3116	CLIP-seq
MIRT1063849	hsa-miR-3117-3p	CLIP-seq
MIRT2015143	hsa-miR-3135	CLIP-seq
MIRT2247419	hsa-miR-3161	CLIP-seq
MIRT1063856	hsa-miR-3169	CLIP-seq
MIRT2247420	hsa-miR-3192	CLIP-seq
MIRT1063862	hsa-miR-3197	CLIP-seq
MIRT2247421	hsa-miR-32	CLIP-seq
MIRT2015154	hsa-miR-342-5p	CLIP-seq
MIRT1063864	hsa-miR-3545-3p	CLIP-seq
MIRT2247422	hsa-miR-3610	CLIP-seq
MIRT2247423	hsa-miR-3613-3p	CLIP-seq
MIRT2247424	hsa-miR-3618	CLIP-seq
MIRT2247425	hsa-miR-363	CLIP-seq
MIRT1063867	hsa-miR-3652	CLIP-seq
MIRT2247426	hsa-miR-3663-5p	CLIP-seq
MIRT2247427	hsa-miR-367	CLIP-seq
MIRT1063872	hsa-miR-3689a-3p	CLIP-seq
MIRT1063873	hsa-miR-3689c	CLIP-seq
MIRT2247428	hsa-miR-3689d	CLIP-seq
MIRT1063874	hsa-miR-3690	CLIP-seq
MIRT2247429	hsa-miR-4325	CLIP-seq
MIRT2247430	hsa-miR-4326	CLIP-seq
MIRT2247431	hsa-miR-4417	CLIP-seq
MIRT2247432	hsa-miR-4425	CLIP-seq
MIRT1063887	hsa-miR-4430	CLIP-seq
MIRT2247433	hsa-miR-4433	CLIP-seq
MIRT2247434	hsa-miR-4437	CLIP-seq
MIRT1063890	hsa-miR-4438	CLIP-seq
MIRT2247435	hsa-miR-4483	CLIP-seq
MIRT1063894	hsa-miR-4492	CLIP-seq
MIRT1063896	hsa-miR-4498	CLIP-seq
MIRT2247436	hsa-miR-4504	CLIP-seq
MIRT2015170	hsa-miR-4505	CLIP-seq
MIRT2247437	hsa-miR-4520a-5p	CLIP-seq
MIRT2247438	hsa-miR-4520b-5p	CLIP-seq
MIRT2247439	hsa-miR-4635	CLIP-seq
MIRT1063902	hsa-miR-4638-3p	CLIP-seq
MIRT2015174	hsa-miR-4645-5p	CLIP-seq
MIRT2247440	hsa-miR-4650-5p	CLIP-seq
MIRT2015175	hsa-miR-4656	CLIP-seq
MIRT2247441	hsa-miR-4661-3p	CLIP-seq
MIRT2015176	hsa-miR-4664-5p	CLIP-seq
MIRT2015177	hsa-miR-4673	CLIP-seq
MIRT2247442	hsa-miR-4674	CLIP-seq
MIRT2015178	hsa-miR-4675	CLIP-seq
MIRT2247443	hsa-miR-4680-5p	CLIP-seq
MIRT2247444	hsa-miR-4687-3p	CLIP-seq
MIRT2247445	hsa-miR-4691-5p	CLIP-seq
MIRT2247446	hsa-miR-4716-3p	CLIP-seq
MIRT1063911	hsa-miR-4722-3p	CLIP-seq
MIRT2247447	hsa-miR-4723-5p	CLIP-seq
MIRT1063913	hsa-miR-4728-5p	CLIP-seq
MIRT2015186	hsa-miR-4741	CLIP-seq
MIRT2015187	hsa-miR-4756-3p	CLIP-seq
MIRT1063916	hsa-miR-4759	CLIP-seq
MIRT2247448	hsa-miR-4766-5p	CLIP-seq
MIRT2247449	hsa-miR-4778-3p	CLIP-seq
MIRT2247450	hsa-miR-4797-5p	CLIP-seq
MIRT2247451	hsa-miR-485-5p	CLIP-seq
MIRT2247452	hsa-miR-491-3p	CLIP-seq
MIRT2247453	hsa-miR-501-3p	CLIP-seq
MIRT2247454	hsa-miR-502-3p	CLIP-seq
MIRT1063923	hsa-miR-5095	CLIP-seq
MIRT2015195	hsa-miR-510	CLIP-seq
MIRT2247455	hsa-miR-517b	CLIP-seq
MIRT2247456	hsa-miR-532-3p	CLIP-seq
MIRT2247457	hsa-miR-541	CLIP-seq
MIRT2247458	hsa-miR-542-3p	CLIP-seq
MIRT2247459	hsa-miR-552	CLIP-seq
MIRT1063928	hsa-miR-562	CLIP-seq
MIRT2247460	hsa-miR-583	CLIP-seq
MIRT1063931	hsa-miR-604	CLIP-seq
MIRT1063934	hsa-miR-647	CLIP-seq
MIRT2247461	hsa-miR-654-5p	CLIP-seq
MIRT2247462	hsa-miR-659	CLIP-seq
MIRT2015203	hsa-miR-661	CLIP-seq
MIRT2247463	hsa-miR-665	CLIP-seq
MIRT2247464	hsa-miR-758	CLIP-seq
MIRT1063935	hsa-miR-762	CLIP-seq
MIRT2247465	hsa-miR-764	CLIP-seq
MIRT2247466	hsa-miR-92a	CLIP-seq
MIRT2247467	hsa-miR-92b	CLIP-seq
MIRT2015136	hsa-miR-2116	CLIP-seq
MIRT2247420	hsa-miR-3192	CLIP-seq
MIRT1063872	hsa-miR-3689a-3p	CLIP-seq
MIRT1063873	hsa-miR-3689c	CLIP-seq
MIRT2015160	hsa-miR-378g	CLIP-seq
MIRT2389350	hsa-miR-3919	CLIP-seq
MIRT2015162	hsa-miR-3942-3p	CLIP-seq
MIRT2015168	hsa-miR-4436a	CLIP-seq
MIRT2015179	hsa-miR-4677-5p	CLIP-seq
MIRT2015183	hsa-miR-4725-5p	CLIP-seq
MIRT1063913	hsa-miR-4728-5p	CLIP-seq
MIRT2015187	hsa-miR-4756-3p	CLIP-seq
MIRT2389351	hsa-miR-4764-5p	CLIP-seq
MIRT2015190	hsa-miR-4786-3p	CLIP-seq
MIRT2389352	hsa-miR-4790-3p	CLIP-seq
MIRT2015192	hsa-miR-504	CLIP-seq
MIRT1063821	hsa-miR-124	CLIP-seq
MIRT2451705	hsa-miR-125a-5p	CLIP-seq
MIRT2451706	hsa-miR-125b	CLIP-seq
MIRT2451707	hsa-miR-1273	CLIP-seq
MIRT1063831	hsa-miR-1291	CLIP-seq
MIRT1063837	hsa-miR-150	CLIP-seq
MIRT1063842	hsa-miR-1976	CLIP-seq
MIRT1063846	hsa-miR-298	CLIP-seq
MIRT1063858	hsa-miR-3173-5p	CLIP-seq
MIRT2015147	hsa-miR-3185	CLIP-seq
MIRT1063870	hsa-miR-3670	CLIP-seq
MIRT1063875	hsa-miR-3714	CLIP-seq
MIRT1063877	hsa-miR-3910	CLIP-seq
MIRT2451708	hsa-miR-4286	CLIP-seq
MIRT2451709	hsa-miR-4319	CLIP-seq
MIRT1063911	hsa-miR-4722-3p	CLIP-seq
MIRT1063922	hsa-miR-506	CLIP-seq
MIRT1063821	hsa-miR-124	CLIP-seq
MIRT1063831	hsa-miR-1291	CLIP-seq
MIRT1063846	hsa-miR-298	CLIP-seq
MIRT1063858	hsa-miR-3173-5p	CLIP-seq
MIRT1063875	hsa-miR-3714	CLIP-seq
MIRT1063877	hsa-miR-3910	CLIP-seq
MIRT1063922	hsa-miR-506	CLIP-seq
MIRT2550889	hsa-miR-105	CLIP-seq
MIRT1063821	hsa-miR-124	CLIP-seq
MIRT1063829	hsa-miR-1287	CLIP-seq
MIRT1063831	hsa-miR-1291	CLIP-seq
MIRT2550890	hsa-miR-1302	CLIP-seq
MIRT2550891	hsa-miR-1538	CLIP-seq
MIRT1063838	hsa-miR-1909	CLIP-seq
MIRT2550892	hsa-miR-1973	CLIP-seq
MIRT1063842	hsa-miR-1976	CLIP-seq
MIRT2550893	hsa-miR-203	CLIP-seq
MIRT2015137	hsa-miR-2467-3p	CLIP-seq
MIRT1063846	hsa-miR-298	CLIP-seq
MIRT1063849	hsa-miR-3117-3p	CLIP-seq
MIRT2550894	hsa-miR-3117-5p	CLIP-seq
MIRT2550895	hsa-miR-3135b	CLIP-seq
MIRT1063856	hsa-miR-3169	CLIP-seq
MIRT1063858	hsa-miR-3173-5p	CLIP-seq
MIRT2550896	hsa-miR-3607-5p	CLIP-seq
MIRT2550897	hsa-miR-3617	CLIP-seq
MIRT2550898	hsa-miR-3679-3p	CLIP-seq
MIRT1063875	hsa-miR-3714	CLIP-seq
MIRT1063877	hsa-miR-3910	CLIP-seq
MIRT2550899	hsa-miR-410	CLIP-seq
MIRT2550900	hsa-miR-4265	CLIP-seq
MIRT2550901	hsa-miR-4290	CLIP-seq
MIRT2550902	hsa-miR-4296	CLIP-seq
MIRT2550903	hsa-miR-4298	CLIP-seq
MIRT2550904	hsa-miR-4299	CLIP-seq
MIRT2550905	hsa-miR-4322	CLIP-seq
MIRT1063890	hsa-miR-4438	CLIP-seq
MIRT2550906	hsa-miR-4468	CLIP-seq
MIRT2550907	hsa-miR-4643	CLIP-seq
MIRT2550908	hsa-miR-4648	CLIP-seq
MIRT2550909	hsa-miR-4654	CLIP-seq
MIRT1063905	hsa-miR-4690-5p	CLIP-seq
MIRT1063906	hsa-miR-4691-3p	CLIP-seq
MIRT2550910	hsa-miR-4710	CLIP-seq
MIRT1063911	hsa-miR-4722-3p	CLIP-seq
MIRT2550911	hsa-miR-4735-5p	CLIP-seq
MIRT2550912	hsa-miR-4742-5p	CLIP-seq
MIRT2550913	hsa-miR-4745-3p	CLIP-seq
MIRT2550914	hsa-miR-4747-3p	CLIP-seq
MIRT1063916	hsa-miR-4759	CLIP-seq
MIRT2550915	hsa-miR-4769-5p	CLIP-seq
MIRT2015189	hsa-miR-4775	CLIP-seq
MIRT2550916	hsa-miR-4792	CLIP-seq
MIRT2550917	hsa-miR-503	CLIP-seq
MIRT1063922	hsa-miR-506	CLIP-seq
MIRT1063923	hsa-miR-5095	CLIP-seq
MIRT2550918	hsa-miR-522	CLIP-seq
MIRT2015199	hsa-miR-590-3p	CLIP-seq
MIRT2550919	hsa-miR-592	CLIP-seq
MIRT2550920	hsa-miR-597	CLIP-seq
MIRT2550921	hsa-miR-641	CLIP-seq
MIRT2550922	hsa-miR-642b	CLIP-seq
MIRT1063819	hsa-miR-1200	CLIP-seq
MIRT2682763	hsa-miR-125a-3p	CLIP-seq
MIRT1063825	hsa-miR-1270	CLIP-seq
MIRT1063829	hsa-miR-1287	CLIP-seq
MIRT2247414	hsa-miR-139-5p	CLIP-seq
MIRT2550891	hsa-miR-1538	CLIP-seq
MIRT1063842	hsa-miR-1976	CLIP-seq
MIRT2682764	hsa-miR-198	CLIP-seq
MIRT2550893	hsa-miR-203	CLIP-seq
MIRT2550895	hsa-miR-3135b	CLIP-seq
MIRT2247420	hsa-miR-3192	CLIP-seq
MIRT2550896	hsa-miR-3607-5p	CLIP-seq
MIRT2550897	hsa-miR-3617	CLIP-seq
MIRT2247424	hsa-miR-3618	CLIP-seq
MIRT2682765	hsa-miR-3622b-5p	CLIP-seq
MIRT2682766	hsa-miR-3664-5p	CLIP-seq
MIRT2550898	hsa-miR-3679-3p	CLIP-seq
MIRT1063872	hsa-miR-3689a-3p	CLIP-seq
MIRT1063873	hsa-miR-3689c	CLIP-seq
MIRT2682767	hsa-miR-3909	CLIP-seq
MIRT2682768	hsa-miR-3915	CLIP-seq
MIRT2682769	hsa-miR-3928	CLIP-seq
MIRT2682770	hsa-miR-3934	CLIP-seq
MIRT2015163	hsa-miR-3973	CLIP-seq
MIRT2550900	hsa-miR-4265	CLIP-seq
MIRT2550901	hsa-miR-4290	CLIP-seq
MIRT2550902	hsa-miR-4296	CLIP-seq
MIRT2682771	hsa-miR-4300	CLIP-seq
MIRT2682772	hsa-miR-432	CLIP-seq
MIRT2550905	hsa-miR-4322	CLIP-seq
MIRT1063886	hsa-miR-4324	CLIP-seq
MIRT2682773	hsa-miR-4434	CLIP-seq
MIRT2247434	hsa-miR-4437	CLIP-seq
MIRT2682774	hsa-miR-4516	CLIP-seq
MIRT2682775	hsa-miR-4530	CLIP-seq
MIRT2682776	hsa-miR-4531	CLIP-seq
MIRT2682777	hsa-miR-4639-3p	CLIP-seq
MIRT2550907	hsa-miR-4643	CLIP-seq
MIRT2015174	hsa-miR-4645-5p	CLIP-seq
MIRT2550908	hsa-miR-4648	CLIP-seq
MIRT2550909	hsa-miR-4654	CLIP-seq
MIRT2015177	hsa-miR-4673	CLIP-seq
MIRT2247442	hsa-miR-4674	CLIP-seq
MIRT2015180	hsa-miR-4684-5p	CLIP-seq
MIRT1063911	hsa-miR-4722-3p	CLIP-seq
MIRT1063913	hsa-miR-4728-5p	CLIP-seq
MIRT2550912	hsa-miR-4742-5p	CLIP-seq
MIRT2550913	hsa-miR-4745-3p	CLIP-seq
MIRT2550914	hsa-miR-4747-3p	CLIP-seq
MIRT2682778	hsa-miR-4753-5p	CLIP-seq
MIRT2015187	hsa-miR-4756-3p	CLIP-seq
MIRT2682779	hsa-miR-4761-5p	CLIP-seq
MIRT2015188	hsa-miR-4768-5p	CLIP-seq
MIRT2550915	hsa-miR-4769-5p	CLIP-seq
MIRT2247450	hsa-miR-4797-5p	CLIP-seq
MIRT2247451	hsa-miR-485-5p	CLIP-seq
MIRT2550917	hsa-miR-503	CLIP-seq
MIRT2015196	hsa-miR-520g	CLIP-seq
MIRT2015197	hsa-miR-520h	CLIP-seq
MIRT2550918	hsa-miR-522	CLIP-seq
MIRT1063926	hsa-miR-544b	CLIP-seq
MIRT1063933	hsa-miR-620	CLIP-seq
MIRT2550921	hsa-miR-641	CLIP-seq
MIRT2550922	hsa-miR-642b	CLIP-seq
MIRT2015203	hsa-miR-661	CLIP-seq
MIRT2247465	hsa-miR-764	CLIP-seq
MIRT2682780	hsa-miR-920	CLIP-seq
MIRT2682781	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	21993848, 23695682, 24120361, 28827714, 32353859, 33060197, 33723527
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IC	27184415
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	9367539
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	NAS	9367539
GO:0009615	Process	Response to virus	IDA	33723527
GO:0009615	Process	Response to virus	IEA
GO:0016020	Component	Membrane	IEA
GO:0030163	Process	Protein catabolic process	IEA
GO:0030368	Function	Interleukin-17 receptor activity	IBA
GO:0030368	Function	Interleukin-17 receptor activity	IDA	27184415, 33723527
GO:0030368	Function	Interleukin-17 receptor activity	IEA
GO:0030368	Function	Interleukin-17 receptor activity	NAS	9367539
GO:0032736	Process	Positive regulation of interleukin-13 production	IEA
GO:0032747	Process	Positive regulation of interleukin-23 production	IDA	21145111
GO:0032754	Process	Positive regulation of interleukin-5 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	21350122
GO:0038173	Process	Interleukin-17A-mediated signaling pathway	IDA	19825828, 20554964, 31376257, 35183823
GO:0038173	Process	Interleukin-17A-mediated signaling pathway	IDA	9367539
GO:0045087	Process	Innate immune response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	33723527
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050832	Process	Defense response to fungus	IEA
GO:0071621	Process	Granulocyte chemotaxis	IEA
GO:0072537	Process	Fibroblast activation	IDA	21145111
GO:0072538	Process	T-helper 17 type immune response	IEA
GO:0097400	Process	Interleukin-17-mediated signaling pathway	IDA	33723527
GO:0097400	Process	Interleukin-17-mediated signaling pathway	IEA
GO:0097400	Process	Interleukin-17-mediated signaling pathway	IMP	21350122
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	33723527
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA
GO:2000340	Process	Positive regulation of chemokine (C-X-C motif) ligand 1 production	IMP	21350122

Other IDs

• MIM: 605461
• HGNC: 5985
• e!Ensembl: ENSG00000177663

Protein

• UniProt ID: Q96F46
• Protein name: Interleukin-17 receptor A (IL-17 receptor A) (IL-17RA) (CDw217) (CD antigen CD217)
• Protein function: Receptor for IL17A and IL17F, major effector cytokines of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity. Receptor for IL17A (PubMed:17911633, PubMed:9367539). Receptor for IL17F (Pub
• PDB: 3JVF, 4HSA, 4NUX, 5N9B, 5NAN, 7UWL, 7UWM, 7UWN, 7ZAN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16556	IL17R_fnIII_D1	48 → 198	Interleukin-17 receptor, fibronectin-III-like domain 1	Domain
  PF16578	IL17R_fnIII_D2	199 → 303		Domain
  PF08357	SEFIR	378 → 536	SEFIR domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:21993848}.
• Sequence:

  MGAARSPPSAVPGPLLGLLLLLLGVLAPGGASLRLLDHRALVCSQPGLNCTVKNSTCLDD
  SWIHPRNLTPSSPKDLQIQLHFAHTQQGDLFPVAHIEWTLQTDASILYLEGAELSVLQLN
  TNERLCVRFEFLSKLRHHHRRWRFTFSHFVVDPDQEYEVTVHHLPKPIPDGDPNHQSKNF
  LVPDCEHARMKVTTPCMSSGSLWDPNITVETLEAHQLRVSFTLWNESTHYQILLTSFPHM
  ENHSCFEHMHHIPAPRPEEFHQRSNVTLTLRNLKGCCRHQVQIQPFFSSCLNDCLRHSAT
  VSCPEMPDTPEPIPDYMPLWVYWFITGISILLVGSVILLIVCMTWRLAGPGSEKYSDDTK
  YTDGLPAADLIPPPLKPRKVWIIYSADHPLYVDVVLKFAQFLLTACGTEVALDLLEEQAI
  SEAGVMTWVGRQKQEMVESNSKIIVLCSRGTRAKWQALLGRGAPVRLRCDHGKPVGDLFT
  AAMNMILPDFKRPACFGTYVVCYFSEVSCDGDVPDLFGAAPRYPLMDRFEEVYFRIQDLE
  MFQPGRMHRVGELSGDNYLRSPGGRQLRAALDRFRDWQVRCPDWFECENLYSADDQDAPS
  LDEEVFEEPLLPPGTGIVKRAPLVREPGSQACLAIDPLVGEEGGAAVAKLEPHLQPRGQP
  APQPLHTLVLAAEEGALVAAVEPGPLADGAAVRLALAGEGEACPLLGSPGAGRNSVLFLP
  VDPEDSPLGSSTPMASPDLLPEDVREHLEGLMLSLFEQSLSCQAQGGCSRPAMVLTDPHT
  PYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQ
  RQLLFRQLQKNSGWDTMGSESEGPSA

• Sequence length: 866

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Chronic mucocutaneous candidiasis	Likely pathogenic	rs2517164324	RCV004018275	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Immunodeficiency 51	Likely pathogenic; Pathogenic	rs2123797291, rs1330723939, rs2123798029, rs759315432, rs2517158918, rs2061394463, rs2517166028, rs753878546, rs2517164580, rs2517159112, rs1057518744, rs1057519079, rs1057518745, rs1057518746, rs1057518747, rs387906913, rs201128237, rs778624945, rs1601340933, rs1321690789	RCV001378818 RCV001881672 RCV001885597 RCV002021583 RCV002824235 RCV003004983 RCV003448864 RCV003641271 RCV003856953 RCV004555146 RCV000412511 RCV000412594 RCV000412660 RCV000412553 RCV000412583 RCV000023443 RCV000701763 RCV000704330 RCV000804480 RCV001063413	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Psoriasis	Likely pathogenic	rs761716238	RCV002254138	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial Candidiasis, Recessive	Likely benign; Benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IL17RA-related disorder	Likely benign; Conflicting classifications of pathogenicity; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	30979738		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	31548328		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	25526314		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	24780906		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	30786053		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	30686933	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	27415816		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	30686933	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	29487139		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28498497, 29884199		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11966773, 15059275, 15879699, 30604628, 37926850	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	22362575, 23116200, 30109481		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23220496, 27685606, 29026003, 29456832		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	32302698, 33840588	Stimulate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	23220496		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28935156		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30304852, 31628653		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	27787597		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27716046		★☆☆☆☆ Found in Text Mining only
Bladder polyp	Bladder polyp	BEFREE	27716046		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	Pubtator	25612291	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	15829914		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	31572359		★☆☆☆☆ Found in Text Mining only
Capillary malformation (disorder)	Capillary malformation	BEFREE	23026768, 24120361, 25918342, 27930337		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23305119	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27716046		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	39480959	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	20012175		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	30836997	Associate	★☆☆☆☆ Found in Text Mining only
Cheilitis	Cheilitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	23147652		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	27913421		★☆☆☆☆ Found in Text Mining only
Chylomicron retention disease	Chylomicron retention disease	Pubtator	22977190	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28521565		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	25834404, 29548809, 34353876	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	25834404	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25526314, 30628053		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26304506, 32462420	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29548809	Inhibit	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27399111		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29487139		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29487139		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29487139		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	19235914		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19235914	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	39837005	Associate	★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	36979355	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28615416, 30684554		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	33840588	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	29870766		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29183760		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28222445		★☆☆☆☆ Found in Text Mining only
Exfoliative dermatitis	Exfoliative Dermatitis	BEFREE	30969010		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	36790253	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	22687286, 23842754		★☆☆☆☆ Found in Text Mining only
Folliculitis	Folliculitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Generalized pustular psoriasis	Pustular Psoriasis	BEFREE	27106510, 29655177, 30969010		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26755664, 28283885		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26755664, 36325335	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	27941331		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	23501056		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	30474404		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	35767887	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27399111		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	27399111	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	32098966	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	27660002		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	27660002		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	27660002		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30604628		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	30604628	Associate	★☆☆☆☆ Found in Text Mining only
IMMUNODEFICIENCY 51	Immunodeficiency	GENOMICS_ENGLAND_DG	27930337		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
IMMUNODEFICIENCY 51	Immunodeficiency	CLINVAR_DG	27930337		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
IMMUNODEFICIENCY 51	Immunodeficiency	CTD_human_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Inflammatory dermatosis	Dermatitis	BEFREE	28615416		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36081453	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	30207057	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	23147652		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	37808403	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32098966	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	35726350	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	15972674	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30604628		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	30604628	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	30604628		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31137925	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	37808403	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	26755664		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16397230, 17603628		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26261590		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27716046		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25484349, 28283885, 29076381, 31585811		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37808403	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23594390, 39384864	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21845543	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29760692		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	32098966	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	LHGDN	16805377		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25526314, 30628053, 31548328		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	23036697		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31311600		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30334403, 30564960		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33487124	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	12359166, 34054865	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	17202320		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17690908	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23192273		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31548328	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25484349		★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	31572359	Stimulate	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Bullous pemphigoid	Pubtator	33340282	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28498497		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16397230, 17603628		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32537467	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26347322, 26682981, 27670766, 28217129, 28755058, 28879789, 29870766, 30076642, 30109481, 30304852, 30328108, 31054998, 31421125, 31628653, 31745628		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28298222	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	21647421		★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	BEFREE	30786053		★☆☆☆☆ Found in Text Mining only
Recurrent bronchitis	Bronchitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Recurrent otitis media	Otitis media	HPO_DG			★☆☆☆☆ Found in Text Mining only
Recurrent sinusitis	Sinusitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	25636567		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	31026365		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	11966773		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19066175, 23880957, 28898718, 30160792, 30845171		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	29554915		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	29554915	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	37808403	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	29153431		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31311305		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	27415816, 32650733, 34744511	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26241630, 30979738		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31119798		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26261590		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26261590, 29118466, 33661721	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	25500255		★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	35767887	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	23906968	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27716046	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26241630	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	26848019	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	26607704		★☆☆☆☆ Found in Text Mining only