IKBKE (inhibitor of nuclear factor kappa B kinase subunit epsilon)

Gene

• Entrez ID: 9641
• Gene name: Inhibitor of nuclear factor kappa B kinase subunit epsilon
• Gene symbol: IKBKE
• Synonyms (NCBI Gene): IKK-E, IKK-i, IKKE, IKKI
• Chromosome: 1
• Chromosome location: 1q32.1
• Summary: IKBKE is a noncanonical I-kappa-B (see MIM 164008) kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer (MIM 114480) oncogene and is amplified and overexpressed in over 30% of breast

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003484	hsa-miR-155-5p	qRT-PCR, Western blot	18753206
MIRT003484	hsa-miR-155-5p	Luciferase reporter assay	19177201
MIRT003484	hsa-miR-155-5p	Review	20026422
MIRT006572	hsa-miR-296-5p	Luciferase reporter assay	22114321
MIRT006572	hsa-miR-296-5p	Luciferase reporter assay	22114321
MIRT003484	hsa-miR-155-5p	Proteomics	20584899
MIRT022344	hsa-miR-124-3p	Microarray	18668037
MIRT003484	hsa-miR-155-5p	Luciferase reporter assay, Western blot	24151514
MIRT003484	hsa-miR-155-5p	Luciferase reporter assay, Western blot	24151514
MIRT003484	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT003484	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT003484	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT003484	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT003484	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT003484	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT003484	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT003484	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT1063065	hsa-miR-155	CLIP-seq
MIRT1063066	hsa-miR-2682	CLIP-seq
MIRT1063067	hsa-miR-3190	CLIP-seq
MIRT1063068	hsa-miR-3202	CLIP-seq
MIRT1063069	hsa-miR-34a	CLIP-seq
MIRT1063070	hsa-miR-34c-5p	CLIP-seq
MIRT1063071	hsa-miR-3714	CLIP-seq
MIRT1063072	hsa-miR-449a	CLIP-seq
MIRT1063073	hsa-miR-449b	CLIP-seq
MIRT1063074	hsa-miR-449c	CLIP-seq
MIRT1063075	hsa-miR-4533	CLIP-seq
MIRT1063076	hsa-miR-4717-5p	CLIP-seq
MIRT1063077	hsa-miR-4729	CLIP-seq
MIRT1063078	hsa-miR-4753-5p	CLIP-seq
MIRT1063079	hsa-miR-548ag	CLIP-seq
MIRT1063080	hsa-miR-548ai	CLIP-seq
MIRT1063081	hsa-miR-548an	CLIP-seq
MIRT1063065	hsa-miR-155	CLIP-seq
MIRT1063066	hsa-miR-2682	CLIP-seq
MIRT1063067	hsa-miR-3190	CLIP-seq
MIRT1063068	hsa-miR-3202	CLIP-seq
MIRT1063069	hsa-miR-34a	CLIP-seq
MIRT1063070	hsa-miR-34c-5p	CLIP-seq
MIRT1063071	hsa-miR-3714	CLIP-seq
MIRT1063072	hsa-miR-449a	CLIP-seq
MIRT1063073	hsa-miR-449b	CLIP-seq
MIRT1063074	hsa-miR-449c	CLIP-seq
MIRT1063075	hsa-miR-4533	CLIP-seq
MIRT1063079	hsa-miR-548ag	CLIP-seq
MIRT1063080	hsa-miR-548ai	CLIP-seq
MIRT1063081	hsa-miR-548an	CLIP-seq
MIRT2247226	hsa-miR-4459	CLIP-seq
MIRT2451670	hsa-miR-1976	CLIP-seq
MIRT2451671	hsa-miR-3183	CLIP-seq
MIRT2247226	hsa-miR-4459	CLIP-seq
MIRT2451672	hsa-miR-4695-5p	CLIP-seq
MIRT2451673	hsa-miR-4723-3p	CLIP-seq
MIRT2451674	hsa-miR-665	CLIP-seq
MIRT2550643	hsa-miR-1252	CLIP-seq
MIRT2550644	hsa-miR-1282	CLIP-seq
MIRT2550645	hsa-miR-1321	CLIP-seq
MIRT2550646	hsa-miR-146b-3p	CLIP-seq
MIRT2550647	hsa-miR-185	CLIP-seq
MIRT2550648	hsa-miR-1915	CLIP-seq
MIRT2550649	hsa-miR-192	CLIP-seq
MIRT2550650	hsa-miR-193a-3p	CLIP-seq
MIRT2550651	hsa-miR-193b	CLIP-seq
MIRT2451670	hsa-miR-1976	CLIP-seq
MIRT2550652	hsa-miR-2110	CLIP-seq
MIRT2550653	hsa-miR-215	CLIP-seq
MIRT2550654	hsa-miR-24	CLIP-seq
MIRT2550655	hsa-miR-2467-5p	CLIP-seq
MIRT2550656	hsa-miR-3125	CLIP-seq
MIRT2550657	hsa-miR-3133	CLIP-seq
MIRT2550658	hsa-miR-3162-5p	CLIP-seq
MIRT2550659	hsa-miR-3173-5p	CLIP-seq
MIRT2550660	hsa-miR-3176	CLIP-seq
MIRT2451671	hsa-miR-3183	CLIP-seq
MIRT2550661	hsa-miR-3187-3p	CLIP-seq
MIRT2550662	hsa-miR-3188	CLIP-seq
MIRT2550663	hsa-miR-337-3p	CLIP-seq
MIRT1063069	hsa-miR-34a	CLIP-seq
MIRT1063070	hsa-miR-34c-5p	CLIP-seq
MIRT2550664	hsa-miR-3916	CLIP-seq
MIRT2550665	hsa-miR-3922-3p	CLIP-seq
MIRT2550666	hsa-miR-3975	CLIP-seq
MIRT2550667	hsa-miR-421	CLIP-seq
MIRT2550668	hsa-miR-4264	CLIP-seq
MIRT2550669	hsa-miR-4271	CLIP-seq
MIRT2550670	hsa-miR-4292	CLIP-seq
MIRT2550671	hsa-miR-4306	CLIP-seq
MIRT2550672	hsa-miR-4423-5p	CLIP-seq
MIRT2550673	hsa-miR-4435	CLIP-seq
MIRT2550674	hsa-miR-4457	CLIP-seq
MIRT2247226	hsa-miR-4459	CLIP-seq
MIRT2550675	hsa-miR-4476	CLIP-seq
MIRT1063072	hsa-miR-449a	CLIP-seq
MIRT1063073	hsa-miR-449b	CLIP-seq
MIRT1063075	hsa-miR-4533	CLIP-seq
MIRT2550676	hsa-miR-4635	CLIP-seq
MIRT2550677	hsa-miR-4644	CLIP-seq
MIRT2550678	hsa-miR-4649-3p	CLIP-seq
MIRT2550679	hsa-miR-4667-5p	CLIP-seq
MIRT2550680	hsa-miR-4679	CLIP-seq
MIRT2451672	hsa-miR-4695-5p	CLIP-seq
MIRT2550681	hsa-miR-4700-5p	CLIP-seq
MIRT2550682	hsa-miR-4701-5p	CLIP-seq
MIRT2550683	hsa-miR-4704-3p	CLIP-seq
MIRT2550684	hsa-miR-4709-3p	CLIP-seq
MIRT2451673	hsa-miR-4723-3p	CLIP-seq
MIRT2550685	hsa-miR-4725-3p	CLIP-seq
MIRT2550686	hsa-miR-4725-5p	CLIP-seq
MIRT2550687	hsa-miR-4726-3p	CLIP-seq
MIRT2550688	hsa-miR-4739	CLIP-seq
MIRT2550689	hsa-miR-4756-5p	CLIP-seq
MIRT2550690	hsa-miR-4773	CLIP-seq
MIRT2550691	hsa-miR-4781-3p	CLIP-seq
MIRT2550692	hsa-miR-485-5p	CLIP-seq
MIRT2550693	hsa-miR-504	CLIP-seq
MIRT2550694	hsa-miR-513b	CLIP-seq
MIRT2550695	hsa-miR-513c	CLIP-seq
MIRT2550696	hsa-miR-514b-5p	CLIP-seq
MIRT2550697	hsa-miR-544b	CLIP-seq
MIRT2550698	hsa-miR-548s	CLIP-seq
MIRT2550699	hsa-miR-588	CLIP-seq
MIRT2550700	hsa-miR-604	CLIP-seq
MIRT2550701	hsa-miR-647	CLIP-seq
MIRT2550702	hsa-miR-660	CLIP-seq
MIRT2451674	hsa-miR-665	CLIP-seq
MIRT2550703	hsa-miR-7	CLIP-seq
MIRT2550704	hsa-miR-874	CLIP-seq
MIRT2682708	hsa-miR-1207-3p	CLIP-seq
MIRT2550643	hsa-miR-1252	CLIP-seq
MIRT2682709	hsa-miR-128	CLIP-seq
MIRT2550644	hsa-miR-1282	CLIP-seq
MIRT2550646	hsa-miR-146b-3p	CLIP-seq
MIRT2550647	hsa-miR-185	CLIP-seq
MIRT2682710	hsa-miR-1910	CLIP-seq
MIRT2550648	hsa-miR-1915	CLIP-seq
MIRT2550649	hsa-miR-192	CLIP-seq
MIRT2550650	hsa-miR-193a-3p	CLIP-seq
MIRT2550651	hsa-miR-193b	CLIP-seq
MIRT2451670	hsa-miR-1976	CLIP-seq
MIRT2550652	hsa-miR-2110	CLIP-seq
MIRT2550653	hsa-miR-215	CLIP-seq
MIRT2550654	hsa-miR-24	CLIP-seq
MIRT2682711	hsa-miR-27a	CLIP-seq
MIRT2682712	hsa-miR-27b	CLIP-seq
MIRT2682713	hsa-miR-3064-5p	CLIP-seq
MIRT2550656	hsa-miR-3125	CLIP-seq
MIRT2682714	hsa-miR-3135b	CLIP-seq
MIRT2550659	hsa-miR-3173-5p	CLIP-seq
MIRT2550660	hsa-miR-3176	CLIP-seq
MIRT2451671	hsa-miR-3183	CLIP-seq
MIRT2550661	hsa-miR-3187-3p	CLIP-seq
MIRT2550664	hsa-miR-3916	CLIP-seq
MIRT2550665	hsa-miR-3922-3p	CLIP-seq
MIRT2550667	hsa-miR-421	CLIP-seq
MIRT2550668	hsa-miR-4264	CLIP-seq
MIRT2550669	hsa-miR-4271	CLIP-seq
MIRT2550670	hsa-miR-4292	CLIP-seq
MIRT2550671	hsa-miR-4306	CLIP-seq
MIRT2550673	hsa-miR-4435	CLIP-seq
MIRT2550674	hsa-miR-4457	CLIP-seq
MIRT2247226	hsa-miR-4459	CLIP-seq
MIRT2550675	hsa-miR-4476	CLIP-seq
MIRT1063075	hsa-miR-4533	CLIP-seq
MIRT2550676	hsa-miR-4635	CLIP-seq
MIRT2550677	hsa-miR-4644	CLIP-seq
MIRT2550679	hsa-miR-4667-5p	CLIP-seq
MIRT2550680	hsa-miR-4679	CLIP-seq
MIRT2451672	hsa-miR-4695-5p	CLIP-seq
MIRT2550681	hsa-miR-4700-5p	CLIP-seq
MIRT2550682	hsa-miR-4701-5p	CLIP-seq
MIRT2550683	hsa-miR-4704-3p	CLIP-seq
MIRT2550684	hsa-miR-4709-3p	CLIP-seq
MIRT2451673	hsa-miR-4723-3p	CLIP-seq
MIRT2550685	hsa-miR-4725-3p	CLIP-seq
MIRT2550686	hsa-miR-4725-5p	CLIP-seq
MIRT2550687	hsa-miR-4726-3p	CLIP-seq
MIRT2550693	hsa-miR-504	CLIP-seq
MIRT2550694	hsa-miR-513b	CLIP-seq
MIRT2550695	hsa-miR-513c	CLIP-seq
MIRT2550696	hsa-miR-514b-5p	CLIP-seq
MIRT2550698	hsa-miR-548s	CLIP-seq
MIRT2550699	hsa-miR-588	CLIP-seq
MIRT2550700	hsa-miR-604	CLIP-seq
MIRT2550701	hsa-miR-647	CLIP-seq
MIRT2550702	hsa-miR-660	CLIP-seq
MIRT2451674	hsa-miR-665	CLIP-seq
MIRT2550703	hsa-miR-7	CLIP-seq
MIRT2550704	hsa-miR-874	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
STAT3	Activation	22330135
ZNF382	Repression	20682794

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002218	Process	Activation of innate immune response	IBA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10882136, 12692549, 24882218
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	14743216, 16177806, 16281057, 17568778, 17599067, 17600090, 18636086, 18636090, 19153231, 20188669, 20657822, 21212807, 21903422, 21931555, 22939624, 23096996, 24706939, 25036637, 25852190, 27980081, 28011935, 29251827, 32814053, 33961781, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	20188669
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12692549
GO:0005737	Component	Cytoplasm	IDA	20188669, 24882218
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006950	Process	Response to stress	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	NAS	10421793
GO:0006974	Process	DNA damage response	IEA
GO:0008384	Function	IkappaB kinase activity	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IMP	20188669
GO:0010467	Process	Gene expression	IEA
GO:0010884	Process	Positive regulation of lipid storage	IEA
GO:0010884	Process	Positive regulation of lipid storage	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016605	Component	PML body	IDA	20188669
GO:0016605	Component	PML body	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019903	Function	Protein phosphatase binding	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	24882218
GO:0031966	Component	Mitochondrial membrane	IMP	16876765
GO:0032481	Process	Positive regulation of type I interferon production	IBA
GO:0032481	Process	Positive regulation of type I interferon production	IDA	18636090
GO:0032481	Process	Positive regulation of type I interferon production	IDA	12692549
GO:0032481	Process	Positive regulation of type I interferon production	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0034340	Process	Response to type I interferon	IEA
GO:0035456	Process	Response to interferon-beta	IMP	24882218
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0036435	Function	K48-linked polyubiquitin modification-dependent protein binding	IEA
GO:0036435	Function	K48-linked polyubiquitin modification-dependent protein binding	IMP	24882218
GO:0042802	Function	Identical protein binding	IPI	24882218
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	10882136
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	26934326
GO:0043254	Process	Regulation of protein-containing complex assembly	IEA
GO:0048255	Process	MRNA stabilization	IEA
GO:0051607	Process	Defense response to virus	NAS	17142768, 21931631
GO:0060337	Process	Type I interferon-mediated signaling pathway	IDA	23386060
GO:0060337	Process	Type I interferon-mediated signaling pathway	NAS	17142768, 21931631
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IDA	24882218
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IEA
GO:0070530	Function	K63-linked polyubiquitin modification-dependent protein binding	IMP	24882218
GO:0097400	Process	Interleukin-17-mediated signaling pathway	IEA
GO:0098586	Process	Cellular response to virus	IEA
GO:1902554	Component	Serine/threonine protein kinase complex	NAS	17142768, 21931631

Other IDs

• MIM: 605048
• HGNC: 14552
• e!Ensembl: ENSG00000263528

Protein

• UniProt ID: Q14164
• Protein name: Inhibitor of nuclear factor kappa-B kinase subunit epsilon (I-kappa-B kinase epsilon) (IKK-E) (IKK-epsilon) (IkBKE) (EC 2.7.11.10) (Inducible I kappa-B kinase) (IKK-i)
• Protein function: Serine/threonine kinase that plays an essential role in regulating inflammatory responses to viral infection, through the activation of the type I IFN, NF-kappa-B and STAT signaling. Also involved in TNFA and inflammatory cytokines, like Interle
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	9 → 301	Protein kinase domain	Domain
  PF18396	TBK1_ULD	308 → 393	TANK binding kinase 1 ubiquitin-like domain	Domain
  PF18394	TBK1_CCD1	400 → 646	TANK-binding kinase 1 coiled-coil domain 1	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in spleen followed by thymus, peripheral blood leukocytes, pancreas, placenta. Weakly expressed in lung, kidney, prostate, ovary and colon.
• Sequence:

  MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLR
  KLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVV
  AGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
  HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
  KPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFA
  ETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCV
  LEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG
  AGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSV
  AGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSI
  QQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKY
  QASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKG
  AQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV

• Sequence length: 716

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune connective tissue disease and vasculitis	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	30504235		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	19177201		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28069799		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	25798331, 25847876		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	25798331	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	28198528	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	39524436	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23944604	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16357145, 17574017, 17574021, 21908616, 23816933, 24487029, 28532474, 29563809, 29801480, 30032344, 30289335, 30615901		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17574017, 17574021, 19497997, 19940156, 21182093, 23816933, 25833000, 26177467, 28532474, 29801480, 30289335, 32784074, 35121200, 39684488, 40468448	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20863366, 32783398	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22330135, 32784074	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25833000	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	40468448	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21685032	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22266464	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	26025939	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26025939	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25474241, 31218100		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26498252		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28523736		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28523736, 31869529	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	15879144		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	25798331	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30791439		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30791439		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28683283	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	28683283	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31821710		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28677425, 29048430, 30529153, 30656846		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28677425	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28677425, 29048430, 30529153, 30656846		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22552702, 25656572, 28548934		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	29333957, 39352539	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	21685032	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	19177201		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	19177201	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30794866		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	28683283	Associate	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	23771900, 24155403, 30029010		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27123832		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30504235		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25833000		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	32146614, 39524436	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	21179067, 23535865		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28532474	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	19786281, 25798331		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	19786281		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Glioma	Glioma	BEFREE	28548934		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16357145, 17574017, 17574021, 21908616, 23007157, 23816933, 24487029, 28532474, 29563809, 29801480, 30032344, 30289335, 30615901		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25474241, 31218100		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26934326		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28548934, 29563809, 29801480, 30223576, 30615901, 30791439, 30814890, 31733040		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16357145, 25833000, 28532474, 30615901		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17574021		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	28683283	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31733040		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17574021, 21908616, 22552702, 23771900, 24444711, 27287717, 28532474, 28548934, 29048430, 29101162, 30289335, 30685606		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30528326		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22330135, 27287717, 31406474		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24368730, 28237848, 30933434		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28683283	Stimulate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	23816933		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25474241, 31218100		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19497997, 25474241	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	28069799		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	19786281, 25798331		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	25798331	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17259348	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	28537254		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26498252	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15879144		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29069487		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	30029010	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	26380323	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12676577		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29563809		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26934326		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27145266, 30487159	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	40468448	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25365225, 29801480		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29801480, 31662325	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	19786281, 25798331		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	19786281		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vasculitis	Vasculitis	Pubtator	32146614	Associate	★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	LHGDN	15367631		★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	21200404		★☆☆☆☆ Found in Text Mining only