IGLV1-40 (immunoglobulin lambda variable 1-40)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 28825
Gene name Immunoglobulin lambda variable 1-40
Gene symbol IGLV1-40
Synonyms (NCBI Gene)
IGLV140V1-13
Chromosome 22
Chromosome location 22q11.22
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13 Show/Hide all (13)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0003823 Function Antigen binding NAS 4814727
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region NAS 4814727
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A IGLV1-40
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P01703
Protein name Immunoglobulin lambda variable 1-40 (Ig lambda chain V-I region NEWM)
Protein function V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 24 → 117 Immunoglobulin V-set domain Domain
Sequence 
MAWSPLLLTLLAHCTGSWAQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQL
PGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSG
Sequence length 118
Interactions View interactions

No strongly related genes found yet for IGLV1-40.

No additional diseases found yet through genes similar to IGLV1-40.