IGLL5 (immunoglobulin lambda like polypeptide 5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100423062
Gene name Immunoglobulin lambda like polypeptide 5
Gene symbol IGLL5
Synonyms (NCBI Gene)
IGLIGLVVL-MAR
Chromosome 22
Chromosome location 22q11.22
Summary This gene encodes one of the immunoglobulin lambda-like polypeptides. It is located within the immunoglobulin lambda locus but it does not require somatic rearrangement for expression. The first exon of this gene is unrelated to immunoglobulin variable ge
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT732570 hsa-miR-1185-5p qRT-PCR 33604823
MIRT732571 hsa-miR-3679-5p qRT-PCR 33604823
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003823 Function Antigen binding IBA
GO:0005576 Component Extracellular region IEA
GO:0016064 Process Immunoglobulin mediated immune response IBA
GO:0070062 Component Extracellular exosome HDA 23533145
GO:0071735 Component IgG immunoglobulin complex IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
B9A064
Protein name Immunoglobulin lambda-like polypeptide 5 (G lambda-1) (Germline immunoglobulin lambda 1)
PDB 7T17
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07654 C1-set 117 → 202 Immunoglobulin C1-set domain Domain
Tissue specificity TISSUE SPECIFICITY: Contrary to IGLL1, not expressed in pre-B-cells. {ECO:0000269|PubMed:1703205, ECO:0000269|PubMed:1900243}.
Sequence 
MRPKTGQVGCETPEELGPGPRQRWPLLLLGLAMVAHGLLRPMVAPQSGDPDPGASVGSSR
SSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLF
PPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYL
SLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Sequence length 214
Interactions View interactions

No strongly related genes found yet for IGLL5.

No additional diseases found yet through genes similar to IGLL5.