IGLJ1 (immunoglobulin lambda joining 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 28833
Gene name Immunoglobulin lambda joining 1
Gene symbol IGLJ1
Synonyms (NCBI Gene)
J1
Chromosome 22
Chromosome location 22q11.22
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005576 Component Extracellular region IEA
GO:0005886 Component Plasma membrane IEA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A0A0MT76
Protein name Immunoglobulin lambda joining 1
Protein function J region of the variable domain of immunoglobulin lambda light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocyt
Family and domains
Sequence 
PSRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVL
Sequence length 42
Interactions View interactions

No strongly related genes found yet for IGLJ1.

No additional diseases found yet through genes similar to IGLJ1.