IGLC6 (immunoglobulin lambda constant 6)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 3542
Gene name Immunoglobulin lambda constant 6
Gene symbol IGLC6
Synonyms (NCBI Gene)
IGLC
Chromosome 22
Chromosome location 22q11.22
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21 Show/Hide all (21)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002250 Process Adaptive immune response NAS 20176268
GO:0002376 Process Immune system process IEA
GO:0003823 Function Antigen binding IBA
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A IGLC6
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0CF74
Protein name Immunoglobulin lambda constant 6 (Ig lambda-6 chain C region)
Protein function Constant region of immunoglobulin light chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins s
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07654 C1-set 9 → 94 Immunoglobulin C1-set domain Domain
Sequence 
GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVKVAWKADGSPVNTGVETTTPSK
QSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPAECS
Sequence length 106
Interactions View interactions

No strongly related genes found yet for IGLC6.

No additional diseases found yet through genes similar to IGLC6.