Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	3538
Gene name	Immunoglobulin lambda constant 2
Gene symbol	IGLC2
Synonyms (NCBI Gene)	IGLC
Chromosome	22
Chromosome location	22q11.22

miRTarBase ID	miRNA	Experiments	Reference
MIRT018759	hsa-miR-335-5p	Microarray	18185580

14 Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003823	Function	Antigen binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	22664934, 23580065
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	IBA
GO:0019814	Component	Immunoglobulin complex	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0071735	Component	IgG immunoglobulin complex	IBA
GO:0072562	Component	Blood microparticle	HDA	22516433

MIM	HGNC	e!Ensembl
HGNC	N/A	IGLC2

P0DOY2

Protein name

Immunoglobulin lambda constant 2 (Ig lambda chain C region Kern) (Ig lambda chain C region NIG-64) (Ig lambda chain C region SH) (Ig lambda chain C region X) (Ig lambda-2 chain C region)

Protein function

Constant region of immunoglobulin light chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins s

PDB

1JVK , 1LIL , 1ZVO , 2JB5 , 2JB6 , 3C2A , 3TV3 , 3TWC , 3TYG , 4EOW , 4LLD , 4LLM , 4LLQ , 4LLU , 4LLW , 4LLY , 4O58 , 4O5I , 5IQ7 , 5IQ9 , 6DE7 , 6UMX , 8ECQ , 8ECV , 8ECZ , 8ED1 , 8EDF , 8XLC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07654	C1-set	9 → 94	Immunoglobulin C1-set domain	Domain

Sequence

GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSK
QSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Sequence length

106

Interactions

View interactions

Related Genes Genes most often co-reported with IGLC2 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for IGLC2.

Diseases Linked via Similar Genes Diseases curated for genes most similar to IGLC2 (see Related Genes above), that are NOT already directly curated for IGLC2 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to IGLC2.

IGLC2 (immunoglobulin lambda constant 2)

Bookmark This Gene