IGKV6D-41 (immunoglobulin kappa variable 6D-41 (non-functional))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 28869
Gene name Immunoglobulin kappa variable 6D-41 (non-functional)
Gene symbol IGKV6D-41
Synonyms (NCBI Gene)
A14
Chromosome 2
Chromosome location 2p11.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005576 Component Extracellular region IEA
GO:0005886 Component Plasma membrane IEA
GO:0006955 Process Immune response IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A IGKV6D-41
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A0C4DH26
Protein name Probable non-functional immunoglobulin kappa variable 6D-41
Protein function Probable non-functional open reading frame (ORF) of V region of the variable domain of immunoglobulin light chains (PubMed:24600447). Non-functional ORF generally cannot participate in the synthesis of a productive immunoglobulin chain due to al
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 26 → 115 Immunoglobulin V-set domain Domain
Sequence 
MVSPLQFLRLLLLWVPASRGDVVMTQSPAFLSVTPGEKVTITCQASEGIGNYLYWYQQKP
DQAPKLLIKYASQSISGVPSRFSGSGSGTDFTFTISSLEAEDAATYYCQQGNKHP
Sequence length 115
Interactions View interactions

No strongly related genes found yet for IGKV6D-41.

No additional diseases found yet through genes similar to IGKV6D-41.