IGKV3-20 (immunoglobulin kappa variable 3-20)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 28912
• Gene name: Immunoglobulin kappa variable 3-20
• Gene symbol: IGKV3-20
• Synonyms (NCBI Gene): 13K18, A27, IGKV320
• Chromosome: 2
• Chromosome location: 2p11.2

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003094	Process	Glomerular filtration	IMP	23398317
GO:0003823	Function	Antigen binding	NAS	2997711, 3086710, 3127527, 5027703, 6419127, 6794615
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	2997711, 3086710, 3127527, 5027703, 6419127, 6794615
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005615	Component	Extracellular space	IDA	23398317
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	NAS	2997711, 3086710, 3127527, 5027703, 6419127, 6794615
GO:0016020	Component	Membrane	IEA
GO:0019731	Process	Antibacterial humoral response	IDA	23250751
GO:0019814	Component	Immunoglobulin complex	IBA
GO:0019814	Component	Immunoglobulin complex	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145
GO:0071748	Component	Monomeric IgA immunoglobulin complex	IDA	23250751
GO:0071751	Component	Secretory IgA immunoglobulin complex	IDA	23250751
GO:0071756	Component	Pentameric IgM immunoglobulin complex	IDA	23250751
GO:0072562	Component	Blood microparticle	HDA	22516433

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: IGKV3-20

Protein

• UniProt ID: P01619
• Protein name: Immunoglobulin kappa variable 3-20 (Ig kappa chain V-III region B6) (Ig kappa chain V-III region GOL) (Ig kappa chain V-III region HAH) (Ig kappa chain V-III region HIC) (Ig kappa chain V-III region IARC/BL41) (Ig kappa chain V-III region NG9) (Ig kappa c
• Protein function: V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In
• PDB: 4LRN , 4M62 , 4M8Q , 4OB5 , 4ODX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	26 → 116	Immunoglobulin V-set domain	Domain

• Sequence:

  METPAQLLFLLLLWLPDTTGEIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQK
  PGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP

• Sequence length: 116

Related Genes

No strongly related genes found yet for IGKV3-20.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to IGKV3-20.