IGKV2D-29 (immunoglobulin kappa variable 2D-29)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 28882
Gene name Immunoglobulin kappa variable 2D-29
Gene symbol IGKV2D-29
Synonyms (NCBI Gene)
A2aA2cIGKV2D29
Chromosome 2
Chromosome location 2p11.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005576 Component Extracellular region IEA
GO:0005886 Component Plasma membrane IEA
GO:0006955 Process Immune response IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A IGKV2D-29
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A075B6S2
Protein name Immunoglobulin kappa variable 2D-29
Protein function V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 26 → 118 Immunoglobulin V-set domain Domain
Sequence 
MRLPAQLLGLLMLWIPGSSADIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYW
YLQKPGQPPQLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLP
Sequence length 120
Interactions View interactions

No strongly related genes found yet for IGKV2D-29.

No additional diseases found yet through genes similar to IGKV2D-29.