IGKV1D-33 (immunoglobulin kappa variable 1D-33)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 28896
Gene name Immunoglobulin kappa variable 1D-33
Gene symbol IGKV1D-33
Synonyms (NCBI Gene)
IGKV1D33O8
Chromosome 2
Chromosome location 2p11.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15 Show/Hide all (15)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0003823 Function Antigen binding NAS 809329, 824717, 4435756, 4563064, 4709625, 4893682, 5595110, 7993911
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region NAS 809329, 824717, 4435756, 4563064, 4709625, 4893682, 5595110, 7993911
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A IGKV1D-33
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P01593
Protein name Immunoglobulin kappa variable 1D-33 (Ig kappa chain V-I region AG) (Ig kappa chain V-I region Bi) (Ig kappa chain V-I region Lay) (Ig kappa chain V-I region Ni) (Ig kappa chain V-I region Rei) (Ig kappa chain V-I region Roy) (Ig kappa chain V-I region Scw
Protein function V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In
PDB 1AR2 , 1BWW , 1REI , 1WTL , 4L1H , 5XP1
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 28 → 116 Immunoglobulin V-set domain Domain
Sequence 
MDMRVPAQLLGLLLLWLSGARCDIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQ
KPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLP
Sequence length 117
Interactions View interactions

No strongly related genes found yet for IGKV1D-33.

No additional diseases found yet through genes similar to IGKV1D-33.