IGKV1D-16 (immunoglobulin kappa variable 1D-16)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 28901 |
| Gene name | Immunoglobulin kappa variable 1D-16 |
| Gene symbol | IGKV1D-16 |
| Synonyms (NCBI Gene) |
IGKV1D16L15L15a
|
| Chromosome | 2 |
| Chromosome location | 2p11.2 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|||||||||||
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
P01601 | ||||||||||
| Protein name | Immunoglobulin kappa variable 1D-16 (Ig kappa chain V-I region HK146) (Ig kappa chain V-I region HK189) | ||||||||||
| Protein function | V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In | ||||||||||
| Family and domains |
Pfam
|
||||||||||
| Sequence |
MDMRVLAQLLGLLLLCFPGARCDIQMTQSPSSLSASVGDRVTITCRASQGISSWLAWYQQ |
||||||||||
| Sequence length | 117 | ||||||||||
| Interactions | View interactions | ||||||||||
|
Related Genes
Genes most often co-reported with IGKV1D-16 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to IGKV1D-16 (see Related Genes above), that are NOT already directly curated for IGKV1D-16 itself -- a lead worth checking, not a confirmed association.
0
|
|