IGKV1-16 (immunoglobulin kappa variable 1-16)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 28938
Gene name Immunoglobulin kappa variable 1-16
Gene symbol IGKV1-16
Synonyms (NCBI Gene)
IGKV116L1
Chromosome 2
Chromosome location 2p11.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13 Show/Hide all (13)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0003823 Function Antigen binding NAS 3083240
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region NAS 3083240
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A IGKV1-16
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P04430
Protein name Immunoglobulin kappa variable 1-16 (Ig kappa chain V-I region BAN)
Protein function V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 28 → 117 Immunoglobulin V-set domain Domain
Sequence 
MDMRVLAQLLGLLLLCFPGARCDIQMTQSPSSLSASVGDRVTITCRASQGISNYLAWFQQ
KPGKAPKSLIYAASSLQSGVPSKFSGSGSGTDFTLTISSLQPEDFATYYCQQYNSYP
Sequence length 117
Interactions View interactions

No strongly related genes found yet for IGKV1-16.

No additional diseases found yet through genes similar to IGKV1-16.