IGHV3-38 (immunoglobulin heavy variable 3-38 (non-functional))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 28429
Gene name Immunoglobulin heavy variable 3-38 (non-functional)
Gene symbol IGHV3-38
Synonyms (NCBI Gene)
IGHV338VH
Chromosome 14
Chromosome location 14q32.33
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0003823 Function Antigen binding IBA
GO:0005576 Component Extracellular region IEA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A IGHV3-38
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A0C4DH36
Protein name Probable non-functional immunoglobulin heavy variable 3-38
Protein function Probable non-functional open reading frame (ORF) of V region of the variable domain of immunoglobulin heavy chains (PubMed:24600447). Non-functional ORF generally cannot participate in the synthesis of a productive immunoglobulin chain due to al
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 28 → 116 Immunoglobulin V-set domain Domain
Sequence 
MQFVLSWVFLVGILKGVQCEVQLVESGGGLVQPRGSLRLSCAASGFTVSSNEMSWIRQAP
GKGLEWVSSISGGSTYYADSRKGRFTISRDNSKNTLYLQMNNLRAEGTAVYYCARY
Sequence length 116
Interactions View interactions

No strongly related genes found yet for IGHV3-38.

No additional diseases found yet through genes similar to IGHV3-38.