IGHV3-23 (immunoglobulin heavy variable 3-23)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 28442
Gene name Immunoglobulin heavy variable 3-23
Gene symbol IGHV3-23
Synonyms (NCBI Gene)
DP47IGHV323V3-23VH26
Chromosome 14
Chromosome location 14q32.33
Summary IGHV3-23 belongs to a cluster of approximately 40 functional variable (V) genes in the immunoglobulin (Ig) heavy chain locus on chromosome 14. For background information on the Ig heavy chain and the V gene cluster, see (MIM 147070).[supplied by OMIM, Apr
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16 Show/Hide all (16)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0003823 Function Antigen binding IBA
GO:0003823 Function Antigen binding NAS 409716, 4139708, 4522793, 6450418
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
611939 5588 ENSG00000211949
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P01764
Protein name Immunoglobulin heavy variable 3-23 (Ig heavy chain V-III region LAY) (Ig heavy chain V-III region POM) (Ig heavy chain V-III region TEI) (Ig heavy chain V-III region TIL) (Ig heavy chain V-III region TUR) (Ig heavy chain V-III region VH26) (Ig heavy chain
Protein function V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In
PDB 1OHQ , 3BN9 , 3UPC , 3ZHD , 3ZHK , 3ZHL , 4KFZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 26 → 117 Immunoglobulin V-set domain Domain
Sequence 
MEFGLSWLFLVAILKGVQCEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAP
GKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
Sequence length 117
Interactions View interactions

No strongly related genes found yet for IGHV3-23.

No additional diseases found yet through genes similar to IGHV3-23.