IGHV1-69 (immunoglobulin heavy variable 1-69)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 28461
Gene name Immunoglobulin heavy variable 1-69
Gene symbol IGHV1-69
Synonyms (NCBI Gene)
IGHV1-EIGHV169IGHV1E
Chromosome 14
Chromosome location 14q32.33
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018954 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13 Show/Hide all (13)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0003823 Function Antigen binding IBA
GO:0003823 Function Antigen binding NAS 5489771, 7028111
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A IGHV1-69
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P01742
Protein name Immunoglobulin heavy variable 1-69 (Ig heavy chain V-I region EU) (Ig heavy chain V-I region SIE) (Ig heavy chain V-I region WOL)
Protein function V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 25 → 117 Immunoglobulin V-set domain Domain
Sequence 
MDWTWRFLFVVAAATGVQSQVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAP
GQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCAR
Sequence length 117
Interactions View interactions

No strongly related genes found yet for IGHV1-69.

No additional diseases found yet through genes similar to IGHV1-69.