IGHV1-2 (immunoglobulin heavy variable 1-2)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 28474 |
| Gene name | Immunoglobulin heavy variable 1-2 |
| Gene symbol | IGHV1-2 |
| Synonyms (NCBI Gene) |
IGHV12V35
|
| Chromosome | 14 |
| Chromosome location | 14q32.33 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|||||||||||
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
P23083 | ||||||||||
| Protein name | Immunoglobulin heavy variable 1-2 (Ig heavy chain V-I region ND) (Ig heavy chain V-I region V35) | ||||||||||
| Protein function | V region of the variable domain of immunoglobulin heavy chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In | ||||||||||
| PDB | 1WT5 | ||||||||||
| Family and domains |
Pfam
|
||||||||||
| Sequence |
MDWTWRILFLVAAATGAHSQVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAP |
||||||||||
| Sequence length | 117 | ||||||||||
| Interactions | View interactions | ||||||||||
|
Related Genes
Genes most often co-reported with IGHV1-2 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to IGHV1-2 (see Related Genes above), that are NOT already directly curated for IGHV1-2 itself -- a lead worth checking, not a confirmed association.
0
|
|