IGHG4 (immunoglobulin heavy constant gamma 4 (G4m marker))

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3503
• Gene name: Immunoglobulin heavy constant gamma 4 (G4m marker)
• Gene symbol: IGHG4
• Synonyms (NCBI Gene): -
• Chromosome: 14
• Chromosome location: 14q32.33

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	NAS	20176268
GO:0002376	Process	Immune system process	IEA
GO:0003823	Function	Antigen binding	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	22664934, 23580065
GO:0005615	Component	Extracellular space	NAS	20176268
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	20176268
GO:0006958	Process	Complement activation, classical pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0019731	Process	Antibacterial humoral response	IBA
GO:0019814	Component	Immunoglobulin complex	IEA
GO:0034987	Function	Immunoglobulin receptor binding	IBA
GO:0042571	Component	Immunoglobulin complex, circulating	IBA
GO:0050853	Process	B cell receptor signaling pathway	NAS	20176268
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071735	Component	IgG immunoglobulin complex	NAS	20176268
GO:0072562	Component	Blood microparticle	HDA	22516433

Other IDs

• MIM: 147130
• HGNC: 5528
• e!Ensembl: ENSG00000211892

Protein

• UniProt ID: P01861
• Protein name: Immunoglobulin heavy constant gamma 4 (Ig gamma-4 chain C region)
• Protein function: Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins s
• PDB: 1ADQ , 1BBJ , 2FL5 , 3EO1 , 4B53 , 4C54 , 4C55 , 4D2N , 5HVW , 5LG1 , 5W5M , 5W5N , 6WIB , 6WMH , 6WNA , 6WOL
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07654	C1-set	228 → 312	Immunoglobulin C1-set domain	Domain
  PF07654	C1-set	120 → 208	Immunoglobulin C1-set domain	Domain
  PF07654	C1-set	8 → 90	Immunoglobulin C1-set domain	Domain

• Sequence:

  ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
  GLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSV
  FLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTY
  RVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTK
  NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEG
  NVFSCSVMHEALHNHYTQKSLSLSLGK

• Sequence length: 327

Related Genes

No strongly related genes found yet for IGHG4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to IGHG4.