IGHE (immunoglobulin heavy constant epsilon)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3497
• Gene name: Immunoglobulin heavy constant epsilon
• Gene symbol: IGHE
• Synonyms (NCBI Gene): IgE
• Chromosome: 14
• Chromosome location: 14q32.33

Gene ontology (GO) Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001788	Process	Antibody-dependent cellular cytotoxicity	IDA	30956175
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	NAS	20176268
GO:0002376	Process	Immune system process	IEA
GO:0002450	Process	B cell antigen processing and presentation	IDA	2167225
GO:0003823	Function	Antigen binding	IBA
GO:0003823	Function	Antigen binding	NAS	6300763
GO:0005515	Function	Protein binding	IPI	10917520, 16172256
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	7544003, 8114916, 8551243
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	NAS	20176268
GO:0005886	Component	Plasma membrane	IDA	8976175, 20458139
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	20176268
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	NAS	6300763
GO:0006958	Process	Complement activation, classical pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0016068	Process	Type I hypersensitivity	IDA	8551243
GO:0019731	Process	Antibacterial humoral response	IBA
GO:0019814	Component	Immunoglobulin complex	IEA
GO:0030225	Process	Macrophage differentiation	IDA	30956175
GO:0034987	Function	Immunoglobulin receptor binding	IBA
GO:0034987	Function	Immunoglobulin receptor binding	IDA	10917520, 16172256
GO:0042092	Process	Type 2 immune response	IDA	8114916, 33840121
GO:0042100	Process	B cell proliferation	IDA	8976175
GO:0042113	Process	B cell activation	IEA
GO:0042116	Process	Macrophage activation	IDA	7544003
GO:0042571	Component	Immunoglobulin complex, circulating	IBA
GO:0043303	Process	Mast cell degranulation	IDA	8551243, 33840121
GO:0043308	Process	Eosinophil degranulation	IDA	8114916
GO:0050853	Process	B cell receptor signaling pathway	IDA	8976175
GO:0050853	Process	B cell receptor signaling pathway	NAS	20176268
GO:0071742	Component	IgE immunoglobulin complex	NAS	2, 20176268
GO:0071744	Component	IgE B cell receptor complex	IDA	8976175
GO:0090716	Process	Adaptive immune memory response	IMP	20458139
GO:0090720	Process	Primary adaptive immune response	IMP	20458139
GO:0160006	Process	Fc receptor-mediated immune complex endocytosis	IDA	2167225
GO:1903131	Process	Mononuclear cell differentiation	IEA

Other IDs

• MIM: 147180
• HGNC: 5522
• e!Ensembl: ENSG00000211891

Protein

• UniProt ID: P01854
• Protein name: Immunoglobulin heavy constant epsilon (Ig epsilon chain C region) (Ig epsilon chain C region ND)
• Protein function: Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins s
• PDB: 1F6A , 1FP5 , 1G84 , 1O0V , 2WQR , 2Y7Q , 3H9Y , 3H9Z , 3HA0 , 4EZM , 4GKO , 4GRG , 4GT7 , 4J4P , 4KI1 , 5ANM , 5HYS , 5LGJ , 5LGK , 5MOI , 5MOJ , 5MOK , 5MOL , 5NQW , 6EYO , 6UQR , 7MXI , 7SHT , 7SHU , 7SHY , 7SHZ , 7SI0 , 8C1B , 8C1C , 8Z0T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07654	C1-set	326 → 412	Immunoglobulin C1-set domain	Domain
  PF07654	C1-set	219 → 306	Immunoglobulin C1-set domain	Domain
  PF07654	C1-set	114 → 200	Immunoglobulin C1-set domain	Domain
  PF07654	C1-set	8 → 92	Immunoglobulin C1-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 2]: Expressed in B lymphocytes stimulated with IL4 and CD40. {ECO:0000269|PubMed:1613458}.
• Sequence:

  ASTQSPSVFPLTRCCKNIPSNATSVTLGCLATGYFPEPVMVTWDTGSLNGTTMTLPATTL
  TLSGHYATISLLTVSGAWAKQMFTCRVAHTPSSTDWVDNKTFSVCSRDFTPPTVKILQSS
  CDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTL
  SQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCL
  VVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCR
  VTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWL
  HNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQR
  AVSVNPGK

• Sequence length: 428

Related Genes

No strongly related genes found yet for IGHE.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to IGHE.