IGHD (immunoglobulin heavy constant delta)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3495
• Gene name: Immunoglobulin heavy constant delta
• Gene symbol: IGHD
• Synonyms (NCBI Gene): -
• Chromosome: 14
• Chromosome location: 14q32.33

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	NAS	20176268
GO:0002376	Process	Immune system process	IEA
GO:0003823	Function	Antigen binding	IBA
GO:0003823	Function	Antigen binding	NAS	6787589
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	NAS	20176268
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	20176268
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	NAS	6787589
GO:0006958	Process	Complement activation, classical pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0019731	Process	Antibacterial humoral response	IBA
GO:0019814	Component	Immunoglobulin complex	IEA
GO:0032732	Process	Positive regulation of interleukin-1 production	IDA	8774350
GO:0032732	Process	Positive regulation of interleukin-1 production	IEA
GO:0034987	Function	Immunoglobulin receptor binding	IBA
GO:0042571	Component	Immunoglobulin complex, circulating	IBA
GO:0050853	Process	B cell receptor signaling pathway	NAS	20176268
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071738	Component	IgD immunoglobulin complex	NAS	20176268
GO:0072562	Component	Blood microparticle	HDA	22516433

Other IDs

• MIM: 147170
• HGNC: 5480
• e!Ensembl: ENSG00000211898

Protein

• UniProt ID: P01880
• Protein name: Immunoglobulin heavy constant delta (Ig delta chain C region) (Ig delta chain C region NIG-65) (Ig delta chain C region WAH)
• Protein function: Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins s
• PDB: 1ZVO , 9FMB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00047	ig	173 → 264	Immunoglobulin domain	Domain
  PF07654	C1-set	8 → 91	Immunoglobulin C1-set domain	Domain
  PF07654	C1-set	279 → 362	Immunoglobulin C1-set domain	Domain

• Sequence:

  APTKAPDVFPIISGCRHPKDNSPVVLACLITGYHPTSVTVTWYMGTQSQPQRTFPEIQRR
  DSYYMTSSQLSTPLQQWRQGEYKCVVQHTASKSKKEIFRWPESPKAQASSVPTAQPQAEG
  SLAKATTAPATTRNTGRGGEEKKKEKEKEEQEERETKTPECPSHTQPLGVYLLTPAVQDL
  WLRDKATFTCFVVGSDLKDAHLTWEVAGKVPTGGVEEGLLERHSNGSQSQHSRLTLPRSL
  WNAGTSVTCTLNHPSLPPQRLMALREPAAQAPVKLSLNLLASSDPPEAASWLLCEVSGFS
  PPNILLMWLEDQREVNTSGFAPARPPPQPRSTTFWAWSVLRVPAPPSPQPATYTCVVSHE
  DSRTLLNASRSLEVSYVTDHGPMK

• Sequence length: 384

Related Genes

No strongly related genes found yet for IGHD.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to IGHD.