IGHA2 (immunoglobulin heavy constant alpha 2 (A2m marker))

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3494
• Gene name: Immunoglobulin heavy constant alpha 2 (A2m marker)
• Gene symbol: IGHA2
• Synonyms (NCBI Gene): A2M
• Chromosome: 14
• Chromosome location: 14q32.33

Gene ontology (GO) Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	NAS	20176268
GO:0002376	Process	Immune system process	IEA
GO:0003094	Process	Glomerular filtration	IEA
GO:0003094	Process	Glomerular filtration	IMP	23398317
GO:0003823	Function	Antigen binding	IBA
GO:0003823	Function	Antigen binding	TAS	6421489
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934, 23580065
GO:0005615	Component	Extracellular space	IDA	23398317, 25645918
GO:0005615	Component	Extracellular space	NAS	20176268
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	20176268
GO:0006955	Process	Immune response	NAS	2241915
GO:0006958	Process	Complement activation, classical pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0019731	Process	Antibacterial humoral response	IBA
GO:0019731	Process	Antibacterial humoral response	IDA	23250751
GO:0019731	Process	Antibacterial humoral response	IEA
GO:0019814	Component	Immunoglobulin complex	IEA
GO:0034987	Function	Immunoglobulin receptor binding	IDA	23250751
GO:0042571	Component	Immunoglobulin complex, circulating	IBA
GO:0050853	Process	B cell receptor signaling pathway	NAS	20176268
GO:0060267	Process	Positive regulation of respiratory burst	IDA	24145934
GO:0060267	Process	Positive regulation of respiratory burst	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071745	Component	IgA immunoglobulin complex	NAS	20176268
GO:0071748	Component	Monomeric IgA immunoglobulin complex	IDA	23250751
GO:0071748	Component	Monomeric IgA immunoglobulin complex	IEA
GO:0071751	Component	Secretory IgA immunoglobulin complex	IDA	23250751, 24145934
GO:0071752	Component	Secretory dimeric IgA immunoglobulin complex	IDA	24145934
GO:0071752	Component	Secretory dimeric IgA immunoglobulin complex	IEA
GO:0072562	Component	Blood microparticle	HDA	22516433

Other IDs

• MIM: 147000
• HGNC: 5479
• e!Ensembl: ENSG00000211890

Protein

• UniProt ID: P01877
• Protein name: Immunoglobulin heavy constant alpha 2 (Ig alpha-2 chain C region) (Ig alpha-2 chain C region BUT) (Ig alpha-2 chain C region LAN)
• Protein function: Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins s
• PDB: 3CM9 , 6UE8 , 6UE9 , 6UEA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00047	ig	118 → 206	Immunoglobulin domain	Domain
  PF07654	C1-set	217 → 307	Immunoglobulin C1-set domain	Domain
  PF07654	C1-set	7 → 92	Immunoglobulin C1-set domain	Domain

• Sequence:

  ASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDAS
  GDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNSSQDVTVPCRVPPPPPCCHPRLSLHRPA
  LEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCA
  QPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNELVTLTCLAR
  GFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTYAVTSILRVAAEDWKKGETFSC
  MVGHEALPLAFTQKTIDRMAGKPTHINVSVVMAEADGTCY

• Sequence length: 340

Related Genes

No strongly related genes found yet for IGHA2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to IGHA2.