IGFLR1 (IGF like family receptor 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 79713
Gene name IGF like family receptor 1
Gene symbol IGFLR1
Synonyms (NCBI Gene)
TMEM149
Chromosome 19
Chromosome location 19q13.12
miRNA miRNA information provided by mirtarbase database.
6 Show/Hide all (6)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT030028 hsa-miR-26b-5p Microarray 19088304
MIRT1062364 hsa-miR-1262 CLIP-seq
MIRT1062365 hsa-miR-4701-3p CLIP-seq
MIRT1062364 hsa-miR-1262 CLIP-seq
MIRT1062365 hsa-miR-4701-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21454693
GO:0005654 Component Nucleoplasm IDA
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 21454693
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
614143 23620 ENSG00000126246
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H665
Protein name IGF-like family receptor 1 (Transmembrane protein 149) (U2 small nuclear RNA auxiliary factor 1-like 4)
Protein function Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
Family and domains
Sequence 
MGPGRCLLTALLLLALAPPPEASQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENC
GLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAK
GHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLPLVVLVLLLTLAVIAILL
FILLWHLCWPKEKADPYPYPGLVCGVPNTHTPSSSHLSSPGALETGDTWKEASLLPLLSR
ELSSLASQPLSRLLDELEVLEELIVLLDPEPGPGGGMAHGTTRHLAARYGLPAAWSTFAY
SLRPSRSPLRALIEMVVAREPSASLGQLGTHLAQLGRADALRVLSKLGSSGVCWA
Sequence length 355
Interactions View interactions

No strongly related genes found yet for IGFLR1.

No additional diseases found yet through genes similar to IGFLR1.