IGFL3 (IGF like family member 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 388555
Gene name IGF like family member 3
Gene symbol IGFL3
Synonyms (NCBI Gene)
UNQ483
Chromosome 19
Chromosome location 19q13.32
Summary IGFL3 belongs to the insulin-like growth factor (IGF; see MIM 147440) family of signaling molecules that play critical roles in cellular energy metabolism and in growth and development, especially prenatal growth (Emtage et al., 2006 [PubMed 16890402]).[s
miRNA miRNA information provided by mirtarbase database.
13 Show/Hide all (13)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1062336 hsa-miR-1275 CLIP-seq
MIRT1062337 hsa-miR-1290 CLIP-seq
MIRT1062338 hsa-miR-137 CLIP-seq
MIRT1062339 hsa-miR-299-3p CLIP-seq
MIRT1062340 hsa-miR-3151 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IBA
GO:0005102 Function Signaling receptor binding IPI 21454693
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0005615 Component Extracellular space IDA 21454693
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
610546 32930 ENSG00000188624
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6UXB1
Protein name Insulin growth factor-like family member 3
Protein function Potential ligand of the IGFLR1 cell membrane receptor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14653 IGFL 33 → 115 Insulin growth factor-like family Family
Tissue specificity TISSUE SPECIFICITY: Detected in the cerebellum. {ECO:0000269|PubMed:16890402}.
Sequence 
MRPRCCILALVCWITVFLLQCSKGTTDAPVGSGLWLCQPTPRCGNKIYNPSEQCCYDDAI
LSLKETRRCGSTCTFWPCFELCCPESFGPQQKFLVKLRVLGMKSQCHLSPISRSCTRNRR
HVLYP
Sequence length 125
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
SCOLIOSIS — GWAS catalog 30019117
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Triple Negative Breast Neoplasms Triple negative breast cancer Pubtator 34326372 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only

No strongly related genes found yet for IGFL3.

No additional diseases found yet through genes similar to IGFL3.