IFT70B (intraflagellar transport 70B)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 150737
• Gene name: Intraflagellar transport 70B
• Gene symbol: IFT70B
• Synonyms (NCBI Gene): IFT70, TTC30B, fleer
• Chromosome: 2
• Chromosome location: 2q31.2

miRNA Show/Hide all (43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045703	hsa-miR-125a-5p	CLASH	23622248
MIRT1461257	hsa-miR-1343	CLIP-seq
MIRT1461258	hsa-miR-2116	CLIP-seq
MIRT1461259	hsa-miR-29a	CLIP-seq
MIRT1461260	hsa-miR-29b	CLIP-seq
MIRT1461261	hsa-miR-29c	CLIP-seq
MIRT1461262	hsa-miR-3161	CLIP-seq
MIRT1461263	hsa-miR-323-3p	CLIP-seq
MIRT1461264	hsa-miR-3673	CLIP-seq
MIRT1461265	hsa-miR-4273	CLIP-seq
MIRT1461266	hsa-miR-4289	CLIP-seq
MIRT1461267	hsa-miR-4528	CLIP-seq
MIRT1461268	hsa-miR-4677-5p	CLIP-seq
MIRT1461269	hsa-miR-4684-5p	CLIP-seq
MIRT1461270	hsa-miR-4764-3p	CLIP-seq
MIRT1461271	hsa-miR-4775	CLIP-seq
MIRT1461272	hsa-miR-543	CLIP-seq
MIRT1461273	hsa-miR-548n	CLIP-seq
MIRT1461274	hsa-miR-548t	CLIP-seq
MIRT1461275	hsa-miR-590-3p	CLIP-seq
MIRT1461276	hsa-miR-593	CLIP-seq
MIRT1461277	hsa-miR-767-5p	CLIP-seq
MIRT2138526	hsa-miR-3125	CLIP-seq
MIRT2138527	hsa-miR-3916	CLIP-seq
MIRT2138528	hsa-miR-4261	CLIP-seq
MIRT2138529	hsa-miR-4496	CLIP-seq
MIRT2138530	hsa-miR-450b-5p	CLIP-seq
MIRT2138531	hsa-miR-495	CLIP-seq
MIRT2138532	hsa-miR-507	CLIP-seq
MIRT1461272	hsa-miR-543	CLIP-seq
MIRT2138533	hsa-miR-548aa	CLIP-seq
MIRT2138534	hsa-miR-557	CLIP-seq
MIRT2359446	hsa-miR-141	CLIP-seq
MIRT2359447	hsa-miR-200a	CLIP-seq
MIRT2462611	hsa-miR-124	CLIP-seq
MIRT2462612	hsa-miR-2053	CLIP-seq
MIRT2462613	hsa-miR-3065-5p	CLIP-seq
MIRT2462614	hsa-miR-3714	CLIP-seq
MIRT2462615	hsa-miR-3910	CLIP-seq
MIRT1461271	hsa-miR-4775	CLIP-seq
MIRT2462616	hsa-miR-506	CLIP-seq
MIRT1461275	hsa-miR-590-3p	CLIP-seq
MIRT1461277	hsa-miR-767-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21602787
GO:0005879	Component	Axonemal microtubule	IBA
GO:0005929	Component	Cilium	IEA
GO:0005929	Component	Cilium	NAS	26980730
GO:0005929	Component	Cilium	TAS
GO:0030030	Process	Cell projection organization	IEA
GO:0030992	Component	Intraciliary transport particle B	IBA
GO:0030992	Component	Intraciliary transport particle B	IEA
GO:0030992	Component	Intraciliary transport particle B	IPI	26980730
GO:0035720	Process	Intraciliary anterograde transport	NAS	26980730
GO:0042073	Process	Intraciliary transport	IBA
GO:0042995	Component	Cell projection	IEA
GO:0060271	Process	Cilium assembly	NAS	26980730
GO:0097542	Component	Ciliary tip	TAS
GO:0120170	Function	Intraciliary transport particle B binding	IBA

Other IDs

• MIM: 620742
• HGNC: 26425
• e!Ensembl: ENSG00000196659

Protein

• UniProt ID: Q8N4P2
• Protein name: Intraflagellar transport protein 70B (Tetratricopeptide repeat protein 30B) (TPR repeat protein 30B)
• Protein function: Required for polyglutamylation of axonemal tubulin. Plays a role in anterograde intraflagellar transport (IFT), the process by which cilia precursors are transported from the base of the cilium to the site of their incorporation at the tip. {ECO
• Sequence:

  MAGLSGAQIPDGEFTAVVYRLIRNARYAEAVQLLGGELQRSPRSRAGLSLLGYCYYRLQE
  FALAAECYEQLGQLHPELEQYRLYQAQALYKACLYAEATRVAFLLLDNPAYHSRVLRLQA
  AIKYSEGDLPGSRSLVEQLPSREGGEESGGENETDGQINLGCLLYKEGQYEAACSKFFAA
  LQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGIDVRSVG
  NTLVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDA
  RPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLIYKFLTPYLYD
  FLDAVITCQTAPEEAFIKLDGLAGMLTEVLRKLTIQVQEARHNRDDEAIKKAVNEYDETM
  EKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIG
  FYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPDKKM
  YHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKH
  TIMLRDSVIQECVQFLEHCELHGRNIPAVIEQPLEEERMHVGKNTVTYESRQLKALIYEI
  IGWNI

• Sequence length: 665

Pathways

Reactome Pathway:

Intraflagellar transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
IFT70B-related disorder	Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Syndactyly, type 2	Syndactyly	BEFREE	31306809		★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for IFT70B.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to IFT70B.