IFNL2 (interferon lambda 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 282616
Gene name Interferon lambda 2
Gene symbol IFNL2
Synonyms (NCBI Gene)
IFNL2aIFNL3aIL-28AIL28A
Chromosome 19
Chromosome location 19q13.2
Summary This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28B (IL28B), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region map
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Download as csvDownload as pdf
Transcription factor Regulation Reference
IRF7 Unknown 17785777
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15 Show/Hide all (15)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002385 Process Mucosal immune response ISS
GO:0005102 Function Signaling receptor binding IBA
GO:0005125 Function Cytokine activity IEA
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
607401 18364 ENSG00000183709
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IZJ0
Protein name Interferon lambda-2 (IFN-lambda-2) (Cytokine Zcyto20) (Interleukin-28A) (IL-28A)
Protein function Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15177 IL28A 38 → 196 Interleukin-28A Domain
Sequence 
MKLDMTGDCTPVLVLMAAVLTVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRA
KDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALV
DVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTF
NLFRLLTRDLNCVASGDLCV
Sequence length 200
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Cytokine-cytokine receptor interaction Interleukin-20 family signaling
JAK-STAT signaling pathway  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
Susceptibility to severe COVID-19 Likely risk allele ClinVar —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (41)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Aggressive Periodontitis Aggressive Periodontitis BEFREE 29717481
★★★★★
★☆☆☆☆
Found in Text Mining only
Allergic rhinitis (disorder) Allergic rhinitis BEFREE 29630100
★★★★★
★☆☆☆☆
Found in Text Mining only
Androgen Insensitivity Syndrome Androgen insensitivity syndrome Pubtator 29630100 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Asthma Asthma BEFREE 18564328, 27622317
★★★★★
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 27057098 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune Diseases BEFREE 24973639, 25138017, 27613139
★★★★★
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune disease Pubtator 27613139 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Behcet Syndrome Behcet Syndrome BEFREE 24973639
★★★★★
★☆☆☆☆
Found in Text Mining only
Bladder Neoplasm Bladder Neoplasm BEFREE 22560878, 22962576
★★★★★
★☆☆☆☆
Found in Text Mining only
Bronchiolitis Bronchiolitis Pubtator 24389019 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
IFNL3 3 shared pathwaysCytokine-cytokine receptor interaction, JAK-STAT signaling pathway, Interleukin-20 family signaling Related via 3 shared pathways including Cytokine-cytokine receptor interaction, JAK-STAT signaling pathway. IL26 3 shared pathwaysCytokine-cytokine receptor interaction, JAK-STAT signaling pathway, Interleukin-20 family signaling Related via 3 shared pathways including Cytokine-cytokine receptor interaction, JAK-STAT signaling pathway. IL24 3 shared pathwaysCytokine-cytokine receptor interaction, JAK-STAT signaling pathway, Interleukin-20 family signaling Related via 3 shared pathways including Cytokine-cytokine receptor interaction, JAK-STAT signaling pathway. IFNLR1 3 shared pathwaysCytokine-cytokine receptor interaction, JAK-STAT signaling pathway, Interleukin-20 family signaling Related via 3 shared pathways including Cytokine-cytokine receptor interaction, JAK-STAT signaling pathway. IFNL1 3 shared pathwaysCytokine-cytokine receptor interaction, JAK-STAT signaling pathway, Interleukin-20 family signaling Related via 3 shared pathways including Cytokine-cytokine receptor interaction, JAK-STAT signaling pathway.
Ulcerative colitis Linked via 2 of 5 related genesIL26, IFNLR1 Asthma Linked via 1 of 5 related genesIFNL3 Brain injuries Linked via 1 of 5 related genesIFNL3 Cryoglobulinemia Linked via 1 of 5 related genesIFNL3 Atopic dermatitis Linked via 1 of 5 related genesIFNL3