IFNA21 (interferon alpha 21)

Gene

• Entrez ID: 3452
• Gene name: Interferon alpha 21
• Gene symbol: IFNA21
• Synonyms (NCBI Gene): IFN-alphaI, LeIF F, leIF-F
• Chromosome: 9
• Chromosome location: 9p21.3
• Summary: This gene is a member of the alpha interferon gene cluster on the short arm of chromosome 9. Interferons are cytokines produced in response to viral infection that mediate the immune response and interfere with viral replication. The encoded protein is a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016701	hsa-miR-335-5p	Microarray	18185580
MIRT2451614	hsa-miR-203	CLIP-seq
MIRT2451615	hsa-miR-298	CLIP-seq
MIRT2451616	hsa-miR-627	CLIP-seq
MIRT2451617	hsa-miR-924	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IBA
GO:0002286	Process	T cell activation involved in immune response	IBA
GO:0002312	Process	B cell activation involved in immune response	IBA
GO:0002323	Process	Natural killer cell activation involved in immune response	IBA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005126	Function	Cytokine receptor binding	TAS	6163083
GO:0005132	Function	Type I interferon receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006952	Process	Defense response	IEA
GO:0006959	Process	Humoral immune response	IBA
GO:0043330	Process	Response to exogenous dsRNA	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0060337	Process	Type I interferon-mediated signaling pathway	IBA
GO:0060337	Process	Type I interferon-mediated signaling pathway	NAS	30936491
GO:0098586	Process	Cellular response to virus	NAS	30936491

Other IDs

• MIM: 147584
• HGNC: 5424
• e!Ensembl: ENSG00000137080

Protein

• UniProt ID: P01568
• Protein name: Interferon alpha-21 (IFN-alpha-21) (Interferon alpha-F) (LeIF F)
• Protein function: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00143	Interferon	26 → 185	Interferon alpha/beta domain	Domain

• Sequence:

  MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
  FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLE
  ACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKI
  FQERLRRKE

• Sequence length: 189

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Multisystem inflammatory syndrome in children	risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	37478211	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25350395	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	21307941, 32248921	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	37588055	Associate	★☆☆☆☆ Found in Text Mining only