IDO2 (indoleamine 2,3-dioxygenase 2)

Gene

• Entrez ID: 169355
• Gene name: Indoleamine 2,3-dioxygenase 2
• Gene symbol: IDO2
• Synonyms (NCBI Gene): INDOL1
• Chromosome: 8
• Chromosome location: 8p11.21
• Summary: Along with the enzymes encoded by the INDO (MIM 147435) and TDO2 (MIM 191070) genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway (Ball et al., 2007 [PubMed 17499941]).[supplied by OMIM, Feb 2011]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1059539	hsa-miR-1827	CLIP-seq
MIRT1059540	hsa-miR-2682	CLIP-seq
MIRT1059541	hsa-miR-34a	CLIP-seq
MIRT1059542	hsa-miR-34c-5p	CLIP-seq
MIRT1059543	hsa-miR-3612	CLIP-seq
MIRT1059544	hsa-miR-432	CLIP-seq
MIRT1059545	hsa-miR-4443	CLIP-seq
MIRT1059546	hsa-miR-449a	CLIP-seq
MIRT1059547	hsa-miR-449b	CLIP-seq
MIRT1059548	hsa-miR-449c	CLIP-seq
MIRT1059549	hsa-miR-4797-3p	CLIP-seq
MIRT1059550	hsa-miR-650	CLIP-seq
MIRT2013861	hsa-miR-489	CLIP-seq
MIRT2013862	hsa-miR-514	CLIP-seq
MIRT2013863	hsa-miR-514b-3p	CLIP-seq
MIRT2246042	hsa-miR-579	CLIP-seq
MIRT2246043	hsa-miR-664	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
PTMA	Activation	21176371;21575365

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0004833	Function	Tryptophan 2,3-dioxygenase activity	IBA
GO:0004833	Function	Tryptophan 2,3-dioxygenase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS	17499941
GO:0005829	Component	Cytosol	TAS
GO:0006569	Process	L-tryptophan catabolic process	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019441	Process	L-tryptophan catabolic process to kynurenine	IBA
GO:0019441	Process	L-tryptophan catabolic process to kynurenine	IDA	17671174
GO:0019441	Process	L-tryptophan catabolic process to kynurenine	IEA
GO:0019441	Process	L-tryptophan catabolic process to kynurenine	IEA
GO:0019441	Process	L-tryptophan catabolic process to kynurenine	ISS	17499941
GO:0020037	Function	Heme binding	IEA
GO:0033754	Function	Indoleamine 2,3-dioxygenase activity	IBA
GO:0033754	Function	Indoleamine 2,3-dioxygenase activity	IDA	17671174
GO:0033754	Function	Indoleamine 2,3-dioxygenase activity	IEA
GO:0033754	Function	Indoleamine 2,3-dioxygenase activity	ISS	17499941
GO:0034354	Process	'de novo' NAD+ biosynthetic process from L-tryptophan	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA

Other IDs

• MIM: 612129
• HGNC: 27269
• e!Ensembl: ENSG00000188676

Protein

• UniProt ID: Q6ZQW0
• Protein name: Indoleamine 2,3-dioxygenase 2 (IDO-2) (EC 1.13.11.-) (Indoleamine 2,3-dioxygenase-like protein 1) (Indoleamine-pyrrole 2,3-dioxygenase-like protein 1)
• Protein function: Catalyzes the first and rate limiting step of the catabolism of the essential amino acid tryptophan along the kynurenine pathway (PubMed:17671174). Involved in immune regulation. May not play a significant role in tryptophan-related tumoral resi
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01231	IDO	28 → 414	Indoleamine 2,3-dioxygenase	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in liver, small intestine, spleen, placenta, thymus, lung, brain, kidney, and colon (PubMed:17671174). Also expressed at low level in testis and thyroid. Not expressed in the majority of human tumor samples (>99%) (PubMed:2569
• Sequence:

  MLHFHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIA
  NKLPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFLTMGYVWQEGEAQPAEVL
  PRNLALPFVEVSRNLGLPPILVHSDLVLTNWTKKDPDGFLEIGNLETIISFPGGESLHGF
  ILVTALVEKEAVPGIKALVQATNAILQPNQEALLQALQRLRLSIQDITKTLGQMHDYVDP
  DIFYAGIRIFLSGWKDNPAMPAGLMYEGVSQEPLKYSGGSAAQSTVLHAFDEFLGIRHSK
  ESGDFLYRMRDYMPPSHKAFIEDIHSAPSLRDYILSSGQDHLLTAYNQCVQALAELRSYH
  ITMVTKYLITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILHPRG
  

• Sequence length: 420

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTINODULAR GOITER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROTIZING ENTEROCOLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anhedonia	Anhedonia	BEFREE	29603866		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	29603866	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30266763		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	24391212	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28223071		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28477703		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	37408267, 38003426	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	34099189	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	37408267	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	19476837, 29426021	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18418598	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32536910	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27106797		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	23652797		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	25541686		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	25541686	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28212884		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	34099189	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	40471422	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25415278	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	30374077		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35872931	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19476837, 31444833		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18418598, 21406395, 30469041, 30760888		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	27473286		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28212884		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28477703, 30128151		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36039641	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21406395, 21440489, 31444833		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30760888		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30050435		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	38062922	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19476837, 31444833		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma, familial	Pancreatic carcinoma	BEFREE	29426021		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29426021, 30266763		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	21406395		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19476837, 29426021	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	33804147	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28223071		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	29510755	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	34099189	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	36319978	Associate	★☆☆☆☆ Found in Text Mining only