IDH1 (isocitrate dehydrogenase (NADP(+)) 1)

Gene

• Entrez ID: 3417
• Gene name: Isocitrate dehydrogenase (NADP(+)) 1
• Gene symbol: IDH1
• Synonyms (NCBI Gene): HEL-216, HEL-S-26, IDCD, IDH, IDP, IDPC, PICD
• Chromosome: 2
• Chromosome location: 2q34
• Summary: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs121913499	G>A,C,T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs121913500	C>A,G,T	Likely-pathogenic, not-provided, pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005125	hsa-miR-30a-5p	pSILAC	18668040
MIRT017645	hsa-miR-335-5p	Microarray	18185580
MIRT005125	hsa-miR-30a-5p	Proteomics;Other	18668040
MIRT036500	hsa-miR-1226-3p	CLASH	23622248
MIRT054822	hsa-miR-30c-5p	qRT-PCR, Western blot	24623846
MIRT1059154	hsa-miR-1253	CLIP-seq
MIRT1059155	hsa-miR-1255a	CLIP-seq
MIRT1059156	hsa-miR-1255b	CLIP-seq
MIRT1059157	hsa-miR-133a	CLIP-seq
MIRT1059158	hsa-miR-133b	CLIP-seq
MIRT1059159	hsa-miR-137	CLIP-seq
MIRT1059160	hsa-miR-144	CLIP-seq
MIRT1059161	hsa-miR-1539	CLIP-seq
MIRT1059162	hsa-miR-181a	CLIP-seq
MIRT1059163	hsa-miR-181b	CLIP-seq
MIRT1059164	hsa-miR-181c	CLIP-seq
MIRT1059165	hsa-miR-181d	CLIP-seq
MIRT1059166	hsa-miR-1911	CLIP-seq
MIRT1059167	hsa-miR-194	CLIP-seq
MIRT1059168	hsa-miR-1972	CLIP-seq
MIRT1059169	hsa-miR-1976	CLIP-seq
MIRT1059170	hsa-miR-2114	CLIP-seq
MIRT1059171	hsa-miR-219-1-3p	CLIP-seq
MIRT1059172	hsa-miR-25	CLIP-seq
MIRT1059173	hsa-miR-2682	CLIP-seq
MIRT1059174	hsa-miR-28-3p	CLIP-seq
MIRT1059175	hsa-miR-298	CLIP-seq
MIRT1059176	hsa-miR-3146	CLIP-seq
MIRT1059177	hsa-miR-3152-5p	CLIP-seq
MIRT1059178	hsa-miR-3193	CLIP-seq
MIRT1059179	hsa-miR-32	CLIP-seq
MIRT1059180	hsa-miR-323-3p	CLIP-seq
MIRT1059181	hsa-miR-34a	CLIP-seq
MIRT1059182	hsa-miR-34c-5p	CLIP-seq
MIRT1059183	hsa-miR-3609	CLIP-seq
MIRT1059184	hsa-miR-3613-3p	CLIP-seq
MIRT1059185	hsa-miR-3614-5p	CLIP-seq
MIRT1059186	hsa-miR-362-5p	CLIP-seq
MIRT1059187	hsa-miR-363	CLIP-seq
MIRT1059188	hsa-miR-3659	CLIP-seq
MIRT1059189	hsa-miR-3662	CLIP-seq
MIRT1059190	hsa-miR-367	CLIP-seq
MIRT1059191	hsa-miR-3688-5p	CLIP-seq
MIRT1059192	hsa-miR-3714	CLIP-seq
MIRT1059193	hsa-miR-374a	CLIP-seq
MIRT1059194	hsa-miR-374b	CLIP-seq
MIRT1059195	hsa-miR-384	CLIP-seq
MIRT1059196	hsa-miR-3929	CLIP-seq
MIRT1059197	hsa-miR-3978	CLIP-seq
MIRT1059198	hsa-miR-421	CLIP-seq
MIRT1059199	hsa-miR-4251	CLIP-seq
MIRT1059200	hsa-miR-4255	CLIP-seq
MIRT1059201	hsa-miR-4261	CLIP-seq
MIRT1059202	hsa-miR-4262	CLIP-seq
MIRT1059203	hsa-miR-4291	CLIP-seq
MIRT1059204	hsa-miR-4303	CLIP-seq
MIRT1059205	hsa-miR-4325	CLIP-seq
MIRT1059206	hsa-miR-4329	CLIP-seq
MIRT1059207	hsa-miR-4418	CLIP-seq
MIRT1059208	hsa-miR-4419b	CLIP-seq
MIRT1059209	hsa-miR-4433	CLIP-seq
MIRT1059210	hsa-miR-4434	CLIP-seq
MIRT1059211	hsa-miR-4459	CLIP-seq
MIRT1059212	hsa-miR-4474-5p	CLIP-seq
MIRT1059213	hsa-miR-4478	CLIP-seq
MIRT1059214	hsa-miR-449a	CLIP-seq
MIRT1059215	hsa-miR-449b	CLIP-seq
MIRT1059216	hsa-miR-449c	CLIP-seq
MIRT1059217	hsa-miR-4516	CLIP-seq
MIRT1059218	hsa-miR-4530	CLIP-seq
MIRT1059219	hsa-miR-4637	CLIP-seq
MIRT1059220	hsa-miR-4645-3p	CLIP-seq
MIRT1059221	hsa-miR-4658	CLIP-seq
MIRT1059222	hsa-miR-4659a-5p	CLIP-seq
MIRT1059223	hsa-miR-4659b-5p	CLIP-seq
MIRT1059224	hsa-miR-4662a-3p	CLIP-seq
MIRT1059225	hsa-miR-4668-3p	CLIP-seq
MIRT1059226	hsa-miR-4709-5p	CLIP-seq
MIRT1059227	hsa-miR-4716-5p	CLIP-seq
MIRT1059228	hsa-miR-4719	CLIP-seq
MIRT1059229	hsa-miR-4729	CLIP-seq
MIRT1059230	hsa-miR-4747-5p	CLIP-seq
MIRT1059231	hsa-miR-4758-5p	CLIP-seq
MIRT1059232	hsa-miR-4762-3p	CLIP-seq
MIRT1059233	hsa-miR-4768-3p	CLIP-seq
MIRT1059234	hsa-miR-4773	CLIP-seq
MIRT1059235	hsa-miR-4774-3p	CLIP-seq
MIRT1059236	hsa-miR-4776-3p	CLIP-seq
MIRT1059237	hsa-miR-4780	CLIP-seq
MIRT1059238	hsa-miR-483-3p	CLIP-seq
MIRT1059239	hsa-miR-491-3p	CLIP-seq
MIRT1059240	hsa-miR-494	CLIP-seq
MIRT1059241	hsa-miR-500b	CLIP-seq
MIRT1059242	hsa-miR-501-5p	CLIP-seq
MIRT1059243	hsa-miR-509-3-5p	CLIP-seq
MIRT1059244	hsa-miR-509-5p	CLIP-seq
MIRT1059245	hsa-miR-513b	CLIP-seq
MIRT1059246	hsa-miR-520d-5p	CLIP-seq
MIRT1059247	hsa-miR-524-5p	CLIP-seq
MIRT1059248	hsa-miR-539	CLIP-seq
MIRT1059249	hsa-miR-542-3p	CLIP-seq
MIRT1059250	hsa-miR-543	CLIP-seq
MIRT1059251	hsa-miR-545	CLIP-seq
MIRT1059252	hsa-miR-548ah	CLIP-seq
MIRT1059253	hsa-miR-548t	CLIP-seq
MIRT1059254	hsa-miR-571	CLIP-seq
MIRT1059255	hsa-miR-574-5p	CLIP-seq
MIRT1059256	hsa-miR-586	CLIP-seq
MIRT1059257	hsa-miR-623	CLIP-seq
MIRT1059258	hsa-miR-645	CLIP-seq
MIRT1059259	hsa-miR-889	CLIP-seq
MIRT1059260	hsa-miR-890	CLIP-seq
MIRT1059261	hsa-miR-922	CLIP-seq
MIRT1059262	hsa-miR-92a	CLIP-seq
MIRT1059263	hsa-miR-92b	CLIP-seq
MIRT1059154	hsa-miR-1253	CLIP-seq
MIRT1059155	hsa-miR-1255a	CLIP-seq
MIRT1059156	hsa-miR-1255b	CLIP-seq
MIRT1059160	hsa-miR-144	CLIP-seq
MIRT1059162	hsa-miR-181a	CLIP-seq
MIRT1059163	hsa-miR-181b	CLIP-seq
MIRT1059164	hsa-miR-181c	CLIP-seq
MIRT1059165	hsa-miR-181d	CLIP-seq
MIRT2013812	hsa-miR-1914	CLIP-seq
MIRT1059168	hsa-miR-1972	CLIP-seq
MIRT2013813	hsa-miR-23a	CLIP-seq
MIRT2013814	hsa-miR-23b	CLIP-seq
MIRT2013815	hsa-miR-23c	CLIP-seq
MIRT1059173	hsa-miR-2682	CLIP-seq
MIRT1059175	hsa-miR-298	CLIP-seq
MIRT2013816	hsa-miR-30a	CLIP-seq
MIRT2013817	hsa-miR-30b	CLIP-seq
MIRT2013818	hsa-miR-30c	CLIP-seq
MIRT2013819	hsa-miR-30d	CLIP-seq
MIRT2013820	hsa-miR-30e	CLIP-seq
MIRT1059176	hsa-miR-3146	CLIP-seq
MIRT2013821	hsa-miR-3163	CLIP-seq
MIRT2013822	hsa-miR-339-5p	CLIP-seq
MIRT1059181	hsa-miR-34a	CLIP-seq
MIRT1059182	hsa-miR-34c-5p	CLIP-seq
MIRT1059189	hsa-miR-3662	CLIP-seq
MIRT2013823	hsa-miR-3684	CLIP-seq
MIRT1059192	hsa-miR-3714	CLIP-seq
MIRT2013824	hsa-miR-3974	CLIP-seq
MIRT1059197	hsa-miR-3978	CLIP-seq
MIRT2013825	hsa-miR-410	CLIP-seq
MIRT1059198	hsa-miR-421	CLIP-seq
MIRT1059199	hsa-miR-4251	CLIP-seq
MIRT1059200	hsa-miR-4255	CLIP-seq
MIRT1059201	hsa-miR-4261	CLIP-seq
MIRT1059202	hsa-miR-4262	CLIP-seq
MIRT2013826	hsa-miR-4271	CLIP-seq
MIRT1059203	hsa-miR-4291	CLIP-seq
MIRT1059204	hsa-miR-4303	CLIP-seq
MIRT1059205	hsa-miR-4325	CLIP-seq
MIRT1059206	hsa-miR-4329	CLIP-seq
MIRT1059207	hsa-miR-4418	CLIP-seq
MIRT1059209	hsa-miR-4433	CLIP-seq
MIRT1059210	hsa-miR-4434	CLIP-seq
MIRT1059211	hsa-miR-4459	CLIP-seq
MIRT1059212	hsa-miR-4474-5p	CLIP-seq
MIRT2013827	hsa-miR-4495	CLIP-seq
MIRT1059214	hsa-miR-449a	CLIP-seq
MIRT1059215	hsa-miR-449b	CLIP-seq
MIRT1059216	hsa-miR-449c	CLIP-seq
MIRT1059217	hsa-miR-4516	CLIP-seq
MIRT2013828	hsa-miR-4520a-3p	CLIP-seq
MIRT1059218	hsa-miR-4530	CLIP-seq
MIRT1059224	hsa-miR-4662a-3p	CLIP-seq
MIRT1059225	hsa-miR-4668-3p	CLIP-seq
MIRT1059226	hsa-miR-4709-5p	CLIP-seq
MIRT2013829	hsa-miR-4725-3p	CLIP-seq
MIRT1059229	hsa-miR-4729	CLIP-seq
MIRT1059230	hsa-miR-4747-5p	CLIP-seq
MIRT1059232	hsa-miR-4762-3p	CLIP-seq
MIRT1059233	hsa-miR-4768-3p	CLIP-seq
MIRT2013830	hsa-miR-4775	CLIP-seq
MIRT2013831	hsa-miR-4779	CLIP-seq
MIRT2013832	hsa-miR-490-5p	CLIP-seq
MIRT1059240	hsa-miR-494	CLIP-seq
MIRT1059243	hsa-miR-509-3-5p	CLIP-seq
MIRT1059244	hsa-miR-509-5p	CLIP-seq
MIRT1059246	hsa-miR-520d-5p	CLIP-seq
MIRT1059247	hsa-miR-524-5p	CLIP-seq
MIRT1059248	hsa-miR-539	CLIP-seq
MIRT1059250	hsa-miR-543	CLIP-seq
MIRT1059251	hsa-miR-545	CLIP-seq
MIRT2013833	hsa-miR-590-3p	CLIP-seq
MIRT2013834	hsa-miR-649	CLIP-seq
MIRT2013835	hsa-miR-670	CLIP-seq
MIRT1059259	hsa-miR-889	CLIP-seq
MIRT1059261	hsa-miR-922	CLIP-seq
MIRT1059155	hsa-miR-1255a	CLIP-seq
MIRT1059156	hsa-miR-1255b	CLIP-seq
MIRT2245975	hsa-miR-1303	CLIP-seq
MIRT1059157	hsa-miR-133a	CLIP-seq
MIRT1059158	hsa-miR-133b	CLIP-seq
MIRT1059159	hsa-miR-137	CLIP-seq
MIRT2245976	hsa-miR-145	CLIP-seq
MIRT2245977	hsa-miR-155	CLIP-seq
MIRT2245978	hsa-miR-185	CLIP-seq
MIRT1059166	hsa-miR-1911	CLIP-seq
MIRT2013812	hsa-miR-1914	CLIP-seq
MIRT1059167	hsa-miR-194	CLIP-seq
MIRT2245979	hsa-miR-196a	CLIP-seq
MIRT2245980	hsa-miR-196b	CLIP-seq
MIRT2245981	hsa-miR-19a	CLIP-seq
MIRT2245982	hsa-miR-19b	CLIP-seq
MIRT1059171	hsa-miR-219-1-3p	CLIP-seq
MIRT1059172	hsa-miR-25	CLIP-seq
MIRT1059173	hsa-miR-2682	CLIP-seq
MIRT1059175	hsa-miR-298	CLIP-seq
MIRT2013816	hsa-miR-30a	CLIP-seq
MIRT2013817	hsa-miR-30b	CLIP-seq
MIRT2013818	hsa-miR-30c	CLIP-seq
MIRT2013819	hsa-miR-30d	CLIP-seq
MIRT2013820	hsa-miR-30e	CLIP-seq
MIRT1059176	hsa-miR-3146	CLIP-seq
MIRT2013821	hsa-miR-3163	CLIP-seq
MIRT1059179	hsa-miR-32	CLIP-seq
MIRT1059180	hsa-miR-323-3p	CLIP-seq
MIRT2013822	hsa-miR-339-5p	CLIP-seq
MIRT1059181	hsa-miR-34a	CLIP-seq
MIRT1059182	hsa-miR-34c-5p	CLIP-seq
MIRT2245983	hsa-miR-3607-5p	CLIP-seq
MIRT1059183	hsa-miR-3609	CLIP-seq
MIRT1059184	hsa-miR-3613-3p	CLIP-seq
MIRT1059185	hsa-miR-3614-5p	CLIP-seq
MIRT1059186	hsa-miR-362-5p	CLIP-seq
MIRT1059187	hsa-miR-363	CLIP-seq
MIRT1059188	hsa-miR-3659	CLIP-seq
MIRT1059190	hsa-miR-367	CLIP-seq
MIRT1059191	hsa-miR-3688-5p	CLIP-seq
MIRT2245984	hsa-miR-369-3p	CLIP-seq
MIRT1059192	hsa-miR-3714	CLIP-seq
MIRT1059193	hsa-miR-374a	CLIP-seq
MIRT1059194	hsa-miR-374b	CLIP-seq
MIRT2013824	hsa-miR-3974	CLIP-seq
MIRT2013825	hsa-miR-410	CLIP-seq
MIRT2245985	hsa-miR-425	CLIP-seq
MIRT2013826	hsa-miR-4271	CLIP-seq
MIRT2245986	hsa-miR-4306	CLIP-seq
MIRT1059205	hsa-miR-4325	CLIP-seq
MIRT1059211	hsa-miR-4459	CLIP-seq
MIRT2013827	hsa-miR-4495	CLIP-seq
MIRT1059214	hsa-miR-449a	CLIP-seq
MIRT1059215	hsa-miR-449b	CLIP-seq
MIRT1059216	hsa-miR-449c	CLIP-seq
MIRT2013828	hsa-miR-4520a-3p	CLIP-seq
MIRT1059218	hsa-miR-4530	CLIP-seq
MIRT1059219	hsa-miR-4637	CLIP-seq
MIRT2245987	hsa-miR-4644	CLIP-seq
MIRT1059220	hsa-miR-4645-3p	CLIP-seq
MIRT1059221	hsa-miR-4658	CLIP-seq
MIRT1059222	hsa-miR-4659a-5p	CLIP-seq
MIRT1059223	hsa-miR-4659b-5p	CLIP-seq
MIRT2245988	hsa-miR-4694-3p	CLIP-seq
MIRT1059227	hsa-miR-4716-5p	CLIP-seq
MIRT1059228	hsa-miR-4719	CLIP-seq
MIRT2013829	hsa-miR-4725-3p	CLIP-seq
MIRT1059229	hsa-miR-4729	CLIP-seq
MIRT1059230	hsa-miR-4747-5p	CLIP-seq
MIRT1059231	hsa-miR-4758-5p	CLIP-seq
MIRT2245989	hsa-miR-4777-3p	CLIP-seq
MIRT2013831	hsa-miR-4779	CLIP-seq
MIRT1059238	hsa-miR-483-3p	CLIP-seq
MIRT2013832	hsa-miR-490-5p	CLIP-seq
MIRT1059241	hsa-miR-500b	CLIP-seq
MIRT1059242	hsa-miR-501-5p	CLIP-seq
MIRT1059246	hsa-miR-520d-5p	CLIP-seq
MIRT1059247	hsa-miR-524-5p	CLIP-seq
MIRT1059248	hsa-miR-539	CLIP-seq
MIRT1059249	hsa-miR-542-3p	CLIP-seq
MIRT1059252	hsa-miR-548ah	CLIP-seq
MIRT1059253	hsa-miR-548t	CLIP-seq
MIRT1059254	hsa-miR-571	CLIP-seq
MIRT1059255	hsa-miR-574-5p	CLIP-seq
MIRT2013834	hsa-miR-649	CLIP-seq
MIRT2013835	hsa-miR-670	CLIP-seq
MIRT1059260	hsa-miR-890	CLIP-seq
MIRT1059261	hsa-miR-922	CLIP-seq
MIRT1059262	hsa-miR-92a	CLIP-seq
MIRT1059263	hsa-miR-92b	CLIP-seq
MIRT1059159	hsa-miR-137	CLIP-seq
MIRT2013812	hsa-miR-1914	CLIP-seq
MIRT1059171	hsa-miR-219-1-3p	CLIP-seq
MIRT1059180	hsa-miR-323-3p	CLIP-seq
MIRT2013822	hsa-miR-339-5p	CLIP-seq
MIRT2013824	hsa-miR-3974	CLIP-seq
MIRT1059198	hsa-miR-421	CLIP-seq
MIRT1059205	hsa-miR-4325	CLIP-seq
MIRT1059238	hsa-miR-483-3p	CLIP-seq
MIRT2013832	hsa-miR-490-5p	CLIP-seq
MIRT1059254	hsa-miR-571	CLIP-seq
MIRT2013835	hsa-miR-670	CLIP-seq
MIRT2245976	hsa-miR-145	CLIP-seq
MIRT2245977	hsa-miR-155	CLIP-seq
MIRT2245981	hsa-miR-19a	CLIP-seq
MIRT2245982	hsa-miR-19b	CLIP-seq
MIRT2245983	hsa-miR-3607-5p	CLIP-seq
MIRT2013832	hsa-miR-490-5p	CLIP-seq
MIRT2549058	hsa-miR-1321	CLIP-seq
MIRT1059157	hsa-miR-133a	CLIP-seq
MIRT1059158	hsa-miR-133b	CLIP-seq
MIRT2245976	hsa-miR-145	CLIP-seq
MIRT2245977	hsa-miR-155	CLIP-seq
MIRT2013812	hsa-miR-1914	CLIP-seq
MIRT2245981	hsa-miR-19a	CLIP-seq
MIRT2245982	hsa-miR-19b	CLIP-seq
MIRT2549059	hsa-miR-200b	CLIP-seq
MIRT2549060	hsa-miR-200c	CLIP-seq
MIRT1059173	hsa-miR-2682	CLIP-seq
MIRT2549061	hsa-miR-2909	CLIP-seq
MIRT2549062	hsa-miR-3162-5p	CLIP-seq
MIRT2013822	hsa-miR-339-5p	CLIP-seq
MIRT1059181	hsa-miR-34a	CLIP-seq
MIRT1059182	hsa-miR-34c-5p	CLIP-seq
MIRT2245983	hsa-miR-3607-5p	CLIP-seq
MIRT1059192	hsa-miR-3714	CLIP-seq
MIRT1059193	hsa-miR-374a	CLIP-seq
MIRT1059194	hsa-miR-374b	CLIP-seq
MIRT1059195	hsa-miR-384	CLIP-seq
MIRT1059196	hsa-miR-3929	CLIP-seq
MIRT2549063	hsa-miR-3942-5p	CLIP-seq
MIRT2013824	hsa-miR-3974	CLIP-seq
MIRT1059198	hsa-miR-421	CLIP-seq
MIRT2013826	hsa-miR-4271	CLIP-seq
MIRT2549064	hsa-miR-429	CLIP-seq
MIRT1059203	hsa-miR-4291	CLIP-seq
MIRT2549065	hsa-miR-4318	CLIP-seq
MIRT1059207	hsa-miR-4418	CLIP-seq
MIRT1059208	hsa-miR-4419b	CLIP-seq
MIRT1059211	hsa-miR-4459	CLIP-seq
MIRT2549066	hsa-miR-4474-3p	CLIP-seq
MIRT1059213	hsa-miR-4478	CLIP-seq
MIRT2549067	hsa-miR-448	CLIP-seq
MIRT1059214	hsa-miR-449a	CLIP-seq
MIRT1059215	hsa-miR-449b	CLIP-seq
MIRT1059216	hsa-miR-449c	CLIP-seq
MIRT2013828	hsa-miR-4520a-3p	CLIP-seq
MIRT2549068	hsa-miR-4693-5p	CLIP-seq
MIRT2549069	hsa-miR-4703-5p	CLIP-seq
MIRT1059228	hsa-miR-4719	CLIP-seq
MIRT2013829	hsa-miR-4725-3p	CLIP-seq
MIRT1059229	hsa-miR-4729	CLIP-seq
MIRT2549070	hsa-miR-4739	CLIP-seq
MIRT1059230	hsa-miR-4747-5p	CLIP-seq
MIRT2549071	hsa-miR-4756-5p	CLIP-seq
MIRT1059234	hsa-miR-4773	CLIP-seq
MIRT2245989	hsa-miR-4777-3p	CLIP-seq
MIRT2013831	hsa-miR-4779	CLIP-seq
MIRT2013832	hsa-miR-490-5p	CLIP-seq
MIRT1059239	hsa-miR-491-3p	CLIP-seq
MIRT1059243	hsa-miR-509-3-5p	CLIP-seq
MIRT1059244	hsa-miR-509-5p	CLIP-seq
MIRT1059248	hsa-miR-539	CLIP-seq
MIRT1059251	hsa-miR-545	CLIP-seq
MIRT1059256	hsa-miR-586	CLIP-seq
MIRT1059258	hsa-miR-645	CLIP-seq
MIRT2013835	hsa-miR-670	CLIP-seq
MIRT2549072	hsa-miR-892a	CLIP-seq
MIRT2549058	hsa-miR-1321	CLIP-seq
MIRT1059157	hsa-miR-133a	CLIP-seq
MIRT1059158	hsa-miR-133b	CLIP-seq
MIRT2245976	hsa-miR-145	CLIP-seq
MIRT2245977	hsa-miR-155	CLIP-seq
MIRT2013812	hsa-miR-1914	CLIP-seq
MIRT2245981	hsa-miR-19a	CLIP-seq
MIRT2245982	hsa-miR-19b	CLIP-seq
MIRT2549059	hsa-miR-200b	CLIP-seq
MIRT2549060	hsa-miR-200c	CLIP-seq
MIRT1059173	hsa-miR-2682	CLIP-seq
MIRT2549061	hsa-miR-2909	CLIP-seq
MIRT2549062	hsa-miR-3162-5p	CLIP-seq
MIRT2013822	hsa-miR-339-5p	CLIP-seq
MIRT1059181	hsa-miR-34a	CLIP-seq
MIRT1059182	hsa-miR-34c-5p	CLIP-seq
MIRT2245983	hsa-miR-3607-5p	CLIP-seq
MIRT1059192	hsa-miR-3714	CLIP-seq
MIRT1059193	hsa-miR-374a	CLIP-seq
MIRT1059194	hsa-miR-374b	CLIP-seq
MIRT2549063	hsa-miR-3942-5p	CLIP-seq
MIRT2013824	hsa-miR-3974	CLIP-seq
MIRT1059198	hsa-miR-421	CLIP-seq
MIRT2013826	hsa-miR-4271	CLIP-seq
MIRT2549064	hsa-miR-429	CLIP-seq
MIRT2549065	hsa-miR-4318	CLIP-seq
MIRT1059207	hsa-miR-4418	CLIP-seq
MIRT1059211	hsa-miR-4459	CLIP-seq
MIRT2549066	hsa-miR-4474-3p	CLIP-seq
MIRT2549067	hsa-miR-448	CLIP-seq
MIRT1059214	hsa-miR-449a	CLIP-seq
MIRT1059215	hsa-miR-449b	CLIP-seq
MIRT1059216	hsa-miR-449c	CLIP-seq
MIRT2013828	hsa-miR-4520a-3p	CLIP-seq
MIRT2549068	hsa-miR-4693-5p	CLIP-seq
MIRT2549069	hsa-miR-4703-5p	CLIP-seq
MIRT1059228	hsa-miR-4719	CLIP-seq
MIRT2013829	hsa-miR-4725-3p	CLIP-seq
MIRT1059229	hsa-miR-4729	CLIP-seq
MIRT2549070	hsa-miR-4739	CLIP-seq
MIRT1059230	hsa-miR-4747-5p	CLIP-seq
MIRT2549071	hsa-miR-4756-5p	CLIP-seq
MIRT1059234	hsa-miR-4773	CLIP-seq
MIRT2245989	hsa-miR-4777-3p	CLIP-seq
MIRT2013831	hsa-miR-4779	CLIP-seq
MIRT2013832	hsa-miR-490-5p	CLIP-seq
MIRT1059239	hsa-miR-491-3p	CLIP-seq
MIRT1059243	hsa-miR-509-3-5p	CLIP-seq
MIRT1059244	hsa-miR-509-5p	CLIP-seq
MIRT1059248	hsa-miR-539	CLIP-seq
MIRT1059256	hsa-miR-586	CLIP-seq
MIRT2013835	hsa-miR-670	CLIP-seq
MIRT2549072	hsa-miR-892a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	IDA	19935646
GO:0000287	Function	Magnesium ion binding	IEA
GO:0004450	Function	Isocitrate dehydrogenase (NADP+) activity	IBA
GO:0004450	Function	Isocitrate dehydrogenase (NADP+) activity	IDA	10521434, 19935646, 20171178
GO:0004450	Function	Isocitrate dehydrogenase (NADP+) activity	IEA
GO:0005515	Function	Protein binding	IPI	31983428, 32814053, 35512704
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005777	Component	Peroxisome	IBA
GO:0005777	Component	Peroxisome	IDA	10521434
GO:0005777	Component	Peroxisome	IEA
GO:0005782	Component	Peroxisomal matrix	IEA
GO:0005782	Component	Peroxisomal matrix	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	10521434
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006097	Process	Glyoxylate cycle	IEA
GO:0006099	Process	Tricarboxylic acid cycle	IEA
GO:0006102	Process	Isocitrate metabolic process	IBA
GO:0006102	Process	Isocitrate metabolic process	IDA	10521434, 19935646, 20171178
GO:0006102	Process	Isocitrate metabolic process	IEA
GO:0006103	Process	2-oxoglutarate metabolic process	IDA	19935646
GO:0006103	Process	2-oxoglutarate metabolic process	IEA
GO:0006739	Process	NADP+ metabolic process	IBA
GO:0006740	Process	NADPH regeneration	IEA
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0008585	Process	Female gonad development	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016616	Function	Oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042802	Function	Identical protein binding	IPI	19935646, 21516116, 26436839
GO:0042803	Function	Protein homodimerization activity	IPI	19935646
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0046872	Function	Metal ion binding	IEA
GO:0048545	Process	Response to steroid hormone	IEA
GO:0050661	Function	NADP binding	IEA
GO:0051287	Function	NAD binding	IEA
GO:0060696	Process	Regulation of phospholipid catabolic process	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0071071	Process	Regulation of phospholipid biosynthetic process	IEA
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 147700
• HGNC: 5382
• e!Ensembl: ENSG00000138413

Protein

• UniProt ID: O75874
• Protein name: Isocitrate dehydrogenase [NADP] cytoplasmic (IDH) (IDH1) (EC 1.1.1.42) (Cytosolic NADP-isocitrate dehydrogenase) (IDPc) (NADP(+)-specific ICDH) (Oxalosuccinate decarboxylase)
• Protein function: Catalyzes the NADP(+)-dependent oxidative decarboxylation of isocitrate (D-threo-isocitrate) to 2-ketoglutarate (2-oxoglutarate), which is required by other enzymes such as the phytanoyl-CoA dioxygenase (PubMed:10521434, PubMed:19935646). Plays
• PDB: 1T09, 1T0L, 3INM, 3MAP, 3MAR, 3MAS, 4I3K, 4I3L, 4KZO, 4L03, 4L04, 4L06, 4UMX, 4UMY, 4XRX, 4XS3, 5DE1, 5GIR, 5K10, 5K11, 5L57, 5L58, 5LGE, 5SUN, 5SVF, 5TQH, 5YFM, 5YFN, 6ADG, 6B0Z, 6BKX, 6BKY, 6BKZ, 6BL0, 6BL1, 6BL2, 6IO0, 6O2Y, 6O2Z, 6PAY, 6Q6F, 6U4J, 6VEI, 6VG0, 7PJM, 7PJN, 8BAY, 8HB9, 8T7D, 8T7N, 8T7O
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00180	Iso_dh	9 → 401	Isocitrate/isopropylmalate dehydrogenase	Domain

• Sequence:

  MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
  AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
  VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
  GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
  AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
  KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
  EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL

• Sequence length: 414

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Acute myeloid leukemia	Likely pathogenic; Pathogenic	rs121913499	RCV000445302 RCV005900719	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Acute myeloid leukemia with NPM1 somatic mutations	Likely pathogenic; Pathogenic	rs121913500	RCV006253824	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Astrocytoma IDH-mutant	Likely pathogenic; Pathogenic	rs121913500	RCV006253823 RCV006253949	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cholangiocarcinoma	Pathogenic	rs121913499	RCV005900721	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Enchondromatosis	Likely pathogenic; Pathogenic	rs62193615, rs121913500, rs121913499	RCV002467575 RCV002227447 RCV002227473	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glioblastoma multiforme, somatic	Likely pathogenic; Pathogenic	rs121913500	RCV000144504	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glioma susceptibility 1	Likely pathogenic; Pathogenic	rs121913500, rs121913499	RCV001542733 RCV003323531	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hepatocellular carcinoma	Pathogenic	rs121913499	RCV005900720	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Juvenile type testicular granulosa cell tumor	Likely pathogenic; Pathogenic	rs121913499	RCV006253951	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Maffucci syndrome	Likely pathogenic; Pathogenic	rs121913499	RCV002291276	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Medulloblastoma	Likely pathogenic; Pathogenic	rs121913499	RCV006253950	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Medulloblastoma SHH activated	Pathogenic	rs121913499	RCV006253952	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Metaphyseal chondromatosis	Likely pathogenic; Pathogenic	rs121913500	RCV003387509	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Metaphyseal chondromatosis with D-2-hydroxyglutaric aciduria	Likely pathogenic; Pathogenic	rs121913500	RCV000853347	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neoplasm	Likely pathogenic; Pathogenic	rs121913500, rs121913499	RCV004668802 RCV004668920 RCV004668921 RCV005230284	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Oligodendroglioma	Likely pathogenic; Pathogenic	rs121913500	RCV006253822	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Paroxysmal extreme pain disorder	Likely pathogenic	rs2124849065	RCV001647346	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHONDROMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse midline glioma, H3 K27-altered	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse pediatric-type high-grade glioma, H3-wildtype and IDH-wildtype	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	not provided	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GIANT CELL GLIOBLASTOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOSARCOMA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDH1-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER FAILURE, ACUTE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METAPHYSEAL ENCHONDROMATOSIS WITH D-2-HYDROXYGLUTARIC ACIDURIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	21647154		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	20538800, 21647154, 22809434, 28544751		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	20171147, 20376086, 21647152, 21647154, 21873548, 22020636, 22488406, 23365461, 23954893, 25022553, 25651001, 26016821, 26466372, 29439493, 30692099, 31145495, 31348835, 31586149		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	25324972, 27992414		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	BEFREE	20805365, 21647152		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	25324972, 27992414		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	22397365		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	CTD_human_DG	26285909		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	22064513, 25029120		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29537891, 30412573		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	25766404, 26717940		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22809434		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	20376086, 21504050, 21647152, 21873548, 27460089, 27470916		★☆☆☆☆ Found in Text Mining only
Adult Craniopharyngioma	Craniopharyngioma	BEFREE	22821382		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	23681227		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	29582271		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	CTD_human_DG	20160062		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	21470325, 21643842, 21898821, 22385787, 22396073, 22913971, 22992787, 23082883, 23934175, 24252742, 26210286, 26276726, 26354927, 26493382, 26757882, 27311324, 28327577, 28915860, 29077933, 29186201, 29224049, 29468261, 29663171, 30206763, 30292978, 30710203, 31058967, 31371189, 31508376, 31714292		★☆☆☆☆ Found in Text Mining only
Albinism Oculocutaneous	Oculocutaneous albinism	Pubtator	40156602	Associate	★☆☆☆☆ Found in Text Mining only
ALPHA-THALASSEMIA/MENTAL RETARDATION SYNDROME, NONDELETION TYPE, X-LINKED	alpha-Thalassemia Mental Retardation Syndrome, X-Linked	BEFREE	26918938, 27553586, 27604789, 28795231, 29468261, 29667086, 29730791, 29846902, 30937985, 31096221, 31625205		★☆☆☆☆ Found in Text Mining only
Alternating hemiplegia of childhood	Alternating hemiplegia of childhood	Pubtator	29846902, 31706351	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	19246647, 19554337, 19755387, 19765000, 21088844, 21344322, 21442241, 21955926, 22136423, 22790483, 22904127, 23204232, 23235339, 23451940, 23595628, 23934175, 23934769, 24077805, 24149775, 24160898, 24305719, 24473683, 24748470, 24777756, 24929863, 25471051, 25962792, 26443480, 26911558, 27626492, 27848136, 28110298, 28214203, 28640702, 28851427, 28885120, 29066318, 29739361, 30072066, 30203362, 30878754, 31039537, 31348085, 31371189, 31623667		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Anaplastic Oligoastrocytoma	Anaplastic Oligoastrocytoma	BEFREE	24149775, 24460285, 26918938		★☆☆☆☆ Found in Text Mining only
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	BEFREE	20160062, 21914791, 22396073, 22922798, 23071531, 23486687, 23681562, 23979650, 24149775, 24160898, 24353325, 24460285, 26352098, 27268645, 28640702, 30072066, 30878754		★☆☆☆☆ Found in Text Mining only
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	CTD_human_DG	20160062		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	20171178		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	31748746	Associate	★☆☆☆☆ Found in Text Mining only
Angiocentric glioma	Angiocentric Glioma	BEFREE	22445362		★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	29346478	Associate	★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	22215888, 23796461, 24880135, 26553750, 26617922		★☆☆☆☆ Found in Text Mining only
Angioma	Angioma	CTD_human_DG	22057234		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	36321611	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28652247		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	31068457		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	18985363, 19228619, 19246647, 19340432, 19543740, 19554337, 19737147, 19798509, 19818334, 19915484, 19933982, 19996293, 20473936, 20919607, 21069360, 21088844, 21233669, 21326241, 21343879, 21344322, 21874255, 22136423, 22396072, 22399191, 22410704, 22415316, 22528790, 22772731, 22869205, 22904127, 22922872, 23064941, 23209033, 23235339, 23242283, 23373454, 23432648, 23438035, 23619925, 23877318, 23909061, 23934769, 24305719, 24335697, 24445767, 24519516, 24532263, 24557705, 24599602, 24777756, 24970694, 25164322, 25427834, 25790191, 25797251, 25853694, 25943888, 25962792, 25975377, 26087904, 26210286, 26223576, 26395639, 26493382, 26990854, 27268645, 27311324, 27344556, 27367599, 27460417, 27469217, 27626492, 27780605, 27790861, 27834733, 28042970, 28124097, 28214203, 28255664, 28327577, 28421459, 28547590, 28711227, 28748342, 28801347, 28928859, 28993028, 29016947, 29027701, 29077933, 29221210, 29258767, 29548048, 29663171, 29687258, 29720725, 29741737, 29752851, 29775073, 29777252, 29948615, 30071292, 30113684, 30292978, 30358620, 30407589, 30498891, 30536195, 30710203, 31005161, 31134296, 31177992, 31371189, 31420939, 31431463, 31623593, 31623667, 31637414, 31698124		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	18985363		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	19246647, 19554337, 19744125, 19765000, 19903171, 20847279, 21177338, 21343879, 21558404, 21625441, 21631627, 21717448, 22136423, 22217666, 22238332, 22291938, 22591444, 22785212, 22844452, 22922872, 23481705, 23486687, 23904111, 23918605, 23934769, 24149775, 24264532, 24305719, 24460285, 24557705, 24614622, 24810474, 24877111, 24993250, 25164322, 25376594, 25407774, 25427834, 25701198, 25783747, 25853694, 25934342, 25962792, 26061753, 26087904, 26125858, 26314843, 26354927, 26493382, 26617931, 26824661, 26864347, 26918938, 26957363, 27172220, 27179220, 27268645, 27311324, 27344556, 27401888, 27626492, 27790861, 27834917, 27935156, 28042970, 28122345, 28201752, 28353033, 28360267, 28392842, 28407731, 28450436, 28575485, 28851427, 28871469, 28993028, 29016996, 29042619, 29077933, 29271237, 29335518, 29535392, 29545335, 29550880, 29590424, 29663171, 29687258, 29741737, 29752851, 29948615, 30051528, 30082856, 30277427, 30404651, 30441386, 30504574, 30548945, 30635340, 30705071, 31023364, 31038238, 31134296, 31140557, 31177992, 31248860, 31292202, 31420939, 31435963, 31473790, 31529048, 31623667, 31706351, 31727977, 31733156, 31889117, 31914945, 31941461, 31957551, 31960234, 31984581, 32034446, 32064507, 32101817, 32228694, 32324987, 32434559, 32462389, 32559177, 32572107, 32690110, 32856872, 33077924, 33081848, 33186344, 33216206, 33244787, 33282092, 33524191, 33535600, 33538917, 33622884, 33740099, 33772213, 33914057, 34121368, 34162262, 34257410, 34377594, 34490493, 34618597, 34648115, 34651653, 34792037, 34863298, 34902093, 34991512, 35157758, 35264242, 35287169, 35287567, 35395677, 35409086, 35460555, 35563629, 35615769, 35672531, 35982066, 35994777, 35996504, 36031351, 36076905, 36258151, 36348019, 36350001, 36571817, 36580017, 36613601, 36646712, 36725354, 36739454, 36980184, 37155843, 37185778, 37219717, 37316586, 37374260, 37382607, 37550258, 37574201, 37651614, 37883975, 37884300, 37919784, 37932833, 37947008, 37952042, 38019246, 38168467, 38183430, 38217295, 38238098, 38243818, 38272925, 39238951, 39357189, 39382765, 39459475, 40156602, 40261557, 40358804, 40379848, 40392514, 40400212, 40660102	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	CLINVAR_DG	19798509, 19818334, 21352804, 25157968		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	23687089	Associate	★☆☆☆☆ Found in Text Mining only
ATAXIA, EARLY-ONSET, WITH OCULOMOTOR APRAXIA AND HYPOALBUMINEMIA	Ataxia-oculomotor apraxia	BEFREE	23486687, 24264532, 24929863, 25407774, 28885120		★☆☆☆☆ Found in Text Mining only
Atelosteogenesis type 1	Atelosteogenesis	Pubtator	24353325	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23681227, 27568302, 29278535		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	33491460	Associate	★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	31122820	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	25043045, 25485496, 30352944, 30889491, 31628675		★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasm	Biliary Tract Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	22180306, 30352944, 30908307, 32100259, 33095329, 34145795, 36008616, 36089135	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	26782057		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	20410924, 20508616, 21346257		★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	29576625, 30296521		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	20431032	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	18985363, 19340432, 19359588, 19903171, 20160062, 20304625, 20603105, 21069360, 22015945, 22144470, 22166263, 22343896, 22397365, 22426639, 22427879, 22922798, 23111198, 23307057, 23414134, 23547822, 24077277, 24366912, 25225364, 26538165, 26669865, 26695622, 26839018, 27655638, 27820599, 28148827, 28373671, 28403884, 28571041, 28640702, 28748342, 28948065, 29535392, 29676036, 29849122, 29971034, 30159860, 30539453, 30633389, 31561044		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19359588, 19903171, 19935646, 22015945, 22343896, 22397365, 22426639, 22427879, 23307057, 24077277, 24565682, 26418953, 26494691, 26538165, 26669865, 27655638, 27820599, 27824159, 27935156, 28373671, 28948065, 29287594, 29490917, 29499756, 29535392, 29676036, 29849122, 30277427, 30412573, 32218467, 33632416, 34389641, 34848827, 35460555, 36246555, 36400017, 36434487, 37528722, 40127071, 40569935	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	CLINVAR_DG	23558169, 26619011		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Brain Stem Glioma	Brain Stem Glioma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Brain Stem Neoplasms	Brain stem neoplasms	Pubtator	34587990	Associate	★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	21213123, 21955925, 23900511, 25727224		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	24760710		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23111200, 24760710, 29661250		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24760710, 25757876, 29287594, 29661250, 30189722, 31727977, 33191115, 34327780	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	33964913	Associate	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	24324372, 24903073, 30558073	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20142433, 22453240, 23038259, 24531386, 24622842, 25251602, 26538165, 26686626, 27430238, 27624942, 28705010, 29662077, 32740973, 34440884, 35856894, 36293551, 37118755, 37528157	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19378339, 22180306, 23235339		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	22039037, 22057234	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28403884, 34145795, 34476330	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30305430		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27466707	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28403884, 30153799, 33564363	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	23451042, 28993028, 36812376	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	30377206	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31110157		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	29661250		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32948843	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	22057234, 28860121	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	19228619, 19903171, 22113362, 23547822, 28255664, 28730141, 29460200, 29548048, 29687258, 30579273, 31637414		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	19903171, 26115961, 30170631, 32748499	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chediak-Higashi Syndrome	Chediak-Higashi Syndrome	BEFREE	29581779		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	22674224		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22809434		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	21647152, 21647154		★☆☆☆☆ Found in Text Mining only
Childhood Ganglioglioma	Ganglioglioma	BEFREE	21314850, 27452969, 29040640		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	29582271		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	CTD_human_DG	20160062		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	21470325, 21643842, 21898821, 22385787, 22396073, 22913971, 22992787, 23082883, 23934175, 24252742, 26210286, 26276726, 26354927, 26493382, 26757882, 27311324, 28327577, 28915860, 29077933, 29186201, 29224049, 29468261, 29663171, 30206763, 30292978, 30710203, 31058967, 31371189, 31508376, 31714292		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	22180306, 23863747, 24569570, 25787993, 27460275, 28297679, 28844952, 29776636, 31028664, 31300360		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22180306, 22824796, 24185509, 24406866, 24478380, 24563076, 24760710, 24867389, 24889489, 25526346, 25536104, 26189129, 26245674, 27829278, 28297679, 28403884, 29278425, 29408647, 29551704, 29848569, 29871612, 30156013, 30170977, 30206411, 30615206, 30849962, 30908307, 31028664, 31121195, 31122820, 31300360, 31727977, 32293336, 32416072, 32740973, 32978444, 33017591, 33200197, 33535978, 33579226, 33709779, 33765338, 33767315, 34080753, 34250753, 34440884, 34476330, 34554208, 34608257, 34905094, 34987644, 35171660, 35259259, 35526267, 35802554, 35986087, 36335135, 36335201, 36462464, 36757619, 36848245, 37184679, 38278871, 38394469, 38547421, 39273177, 39803868	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cholangiocarcinoma	Cholangiocarcinoma	CTD_human_DG	24185509		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cholangiocarcinoma	Cholangiocarcinoma	CGI_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Chondroma	Chondroma	CTD_human_DG	22057234, 25895133		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondroma	Chordoma	Pubtator	22057234, 25895133, 35660795, 36480544, 37324278, 39587599	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondroma	Chondroma	BEFREE	25250651, 27461824		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondrosarcoma	Chondrosarcoma	BEFREE	21598255, 22057234, 22323113, 23598960, 23863747, 23954893, 24065766, 25024164, 25432631, 25648524, 25730874, 25895133, 25956465, 26368816, 27355333, 27461824, 28133974, 28552826, 29339836, 29576625, 29581779, 30249606, 30296521, 31028664, 31406254, 31615936		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	22057234, 22824796, 22885298, 23770606, 24098815, 24760710, 25895133, 26161668, 26368816, 28552826, 30206411, 30249606, 31028664, 31297850, 31604924, 31615936, 31869219, 33017591, 33147331, 34440884, 34528398, 34994649, 35198082, 35660795, 35765075, 36335201, 36480544, 36926116, 37747813, 37752419, 39334838, 39684713	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	22323113		★☆☆☆☆ Found in Text Mining only
Chorioangioma	Chorioangioma	CTD_human_DG	22057234		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	35264242	Associate	★☆☆☆☆ Found in Text Mining only
Chromosome 5q Deletion Syndrome	Chromosome 5q deletion syndrome	Pubtator	21523797, 31685963	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27980696		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	20068184, 20410924, 20508616, 22898539, 30353413		★☆☆☆☆ Found in Text Mining only
Cirrhosis Familial	Cirrhosis	Pubtator	31121195, 33767315	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	27848136, 30777895, 30809977	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21996744, 31505989		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	23414134, 24986863	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25496513, 25586680, 25683705, 27655638, 28751160, 29871819		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21996744, 23071355, 25496513, 27824159, 29577594, 32141187, 34145795	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	37076313	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	25536104, 25693006, 26320466, 28297679, 28667006, 29733964		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective tissue disease	Pubtator	32107555	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30153799		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	32948843	Associate	★☆☆☆☆ Found in Text Mining only
Cranial nerve palsies	Cranial Nerve Paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	22821382		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	25029120, 27063727		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	27063727, 33186471	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic neutropenia	Pubtator	32948843	Associate	★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	15065742		★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	BEFREE	21717448, 22217666, 22528790, 22904127, 23934769, 26243269, 26276726, 26303387, 26443480, 26918938, 27344556, 28110298, 28339043, 28377251, 29016996, 29077933, 29444314, 30079885, 30407589, 30878754		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	23681227		★☆☆☆☆ Found in Text Mining only
Disorders of Sex Development	Disorders of sex development	Pubtator	27245312, 29346478, 32393603	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	23291739, 29642018, 35212929	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	29661250		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyschondroplasias	Dyschondroplasias	ORPHANET_DG	22057234, 22057236		★☆☆☆☆ Found in Text Mining only
Dysembryoplastic neuroepithelial tumor	Dysembryoplastic Neuroepithelial Tumor	BEFREE	22192702		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	34389754	Associate	★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	25849605, 26409566, 30190259, 33002860, 33868245	Associate	★☆☆☆☆ Found in Text Mining only
Enchondroma	Enchondroma	BEFREE	22057234, 25730874, 26508204, 29224049, 29339836, 31240473		★☆☆☆☆ Found in Text Mining only
Enchondroma	Enchondroma	CTD_human_DG	22057234, 25895133		★☆☆☆☆ Found in Text Mining only
Enchondromatosis	Enchondromatosis	BEFREE	22057234, 22057236, 23801749, 25730874, 26046462, 27036230, 29339836, 30159860, 31240473		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Enchondromatosis	Enchondromatosis	GENOMICS_ENGLAND_DG	22057234, 22057236		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Enchondromatosis	Enchondromatosis	CTD_human_DG	22057234, 22057236		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Enchondromatosis	Enchondromatosis	ORPHANET_DG	22057234, 22057236		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Enchondromatosis	Enchondromatosis	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29921847		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	19246647, 23934769, 25786545, 31660579		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	21937911, 27406953, 28497669, 29076421, 29172136, 29404978, 30297697		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	30297697, 30809977, 35972438, 36290853	Associate	★☆☆☆☆ Found in Text Mining only
EPILEPSY, PYRIDOXINE-DEPENDENT	Epilepsy	BEFREE	27764705		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Essential tremor	Pubtator	27447873	Associate	★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	CTD_human_DG	24185509		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24867389, 28628842, 31476489		★☆☆☆☆ Found in Text Mining only
Fibrillary Astrocytoma	Fibrillary Astrocytoma	BEFREE	25192052		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	22885298, 28578659, 30355481, 30755816		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28830339		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	23235339		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	20171178, 20702649		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	28567120, 31122820, 31476489		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	31122820	Associate	★☆☆☆☆ Found in Text Mining only
Ganglioglioma	Ganglioglioma	BEFREE	19765000, 21314850, 26115961, 27452969, 27791984, 29040640		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	27655638	Associate	★☆☆☆☆ Found in Text Mining only
Gemistocytic astrocytoma	Gemistocytic Astrocytoma	BEFREE	25192052		★☆☆☆☆ Found in Text Mining only
Genetic Predisposition to Disease	Genetic predisposition to disease	Pubtator	29016839	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	ORPHANET_DG	18772396		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant cell glioblastoma	Giant Cell Glioblastoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Glioblastoma	Giant Cell Glioblastoma	BEFREE	27253461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	24898068	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18772396, 18985363		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18772396, 19246647, 19765000, 19805672, 20127344, 20129251, 20142433, 20171178, 20431032, 20504876, 20847279, 20926426, 21301070, 21314850, 21625441, 21781445, 21910919, 21996744, 22025148, 22034964, 22076165, 22215888, 22238332, 22249618, 22291938, 22322613, 22343889, 22661320, 22672415, 22785212, 22945948, 22997168, 23041832, 23079654, 23109653, 23115158, 23184331, 23223340, 23289977, 23307057, 23361564, 23429602, 23442355, 23451042, 23762372, 23840696, 23918605, 23934175, 23988086, 24267971, 24305712, 24460285, 24510240, 24511544, 24614622, 24832620, 24868540, 25012071, 25033601, 25054200, 25256166, 25277177, 25407774, 25427834, 25562199, 25605197, 25706986, 25732040, 25790191, 25849605, 25934342, 26061753, 26091668, 26124478, 26158269, 26200049, 26238627, 26324126, 26366867, 26405082, 26409566, 26427041, 26443480, 26452024, 26485760, 26498130, 26503470, 26506620, 26757882, 26817999, 26957363, 26967252, 27088883, 27245697, 27268645, 27270107, 27270908, 27409829, 27430238, 27466707, 27478330, 27571882, 27579614, 27820599, 27834917, 27849434, 28178682, 28195901, 28223536, 28255664, 28327577, 28330869, 28339723, 28340142, 28345125, 28467784, 28481241, 28531337, 28571041, 28575485, 28705010, 28785587, 28789475, 28823044, 28869450, 28945795, 28984190, 29016808, 29016839, 29016871, 29105198, 29244145, 29255149, 29272522, 29302887, 29328863, 29454261, 29509313, 29545335, 29556922, 29564591, 29569163, 29572492, 29617848, 29642018, 29687258, 29687495, 29718366, 29741737, 29792149, 29802247, 29941484, 29984907, 30107597, 30152087, 30159779, 30220459, 30222900, 30249606, 30277536, 30404651, 30426720, 30504574, 30548945, 30567605, 30635340, 30668814, 30728876, 30760837, 30811476, 30877769, 30894197, 30905762, 30926639, 30943868, 30987862, 30991024, 31159876, 31167648, 31215469, 31289907, 31346613, 31371348, 31434323, 31479414, 31623593, 31623667, 31637414, 31665443, 31746408, 31804140, 31869219, 31984581, 32027343, 32034446, 32080088, 32146793, 32151286, 32160197, 32297889, 32310827, 32355162, 32382048, 32433536, 32488994, 32620753, 32678261, 32705169, 32716208, 32748120, 32748499, 32762688, 32820151, 32851059, 32888020, 32897363, 33002860, 33059718, 33077924, 33130898, 33142244, 33206320, 33282092, 33317554, 33480239, 33509914, 33577785, 33631540, 33692446, 33759174, 33778723, 33801093, 33803224, 33838014, 33853673, 33868245, 33876327, 33881725, 33900414, 33972663, 34011400, 34020723, 34060283, 34065652, 34078827, 34162262, 34193272, 34232320, 34257620, 34269536, 34377594, 34490493, 34496929, 34525361, 34594037, 34606414, 34648115, 34675100, 34782726, 34859824, 34878541, 34880206, 34899682, 34939129, 34952640, 34991512, 35043686, 35103816, 35138915, 35211690, 35212929, 35303420, 35331339, 35332262, 35395677, 35397757, 35460555, 35562953, 35612598, 35615769, 35660939, 35695190, 35738587, 35815721, 35868257, 35945463, 35953681, 35972438, 35994777, 36011350, 36091049, 36248907, 36329288, 36335201, 36350010, 36389748, 36647073, 36877775, 36898379, 36915208, 37066523, 37155843, 37158834, 37187346, 37212470, 37227648, 37230028, 37277265, 37279174, 37382632, 37402102, 37481865, 37494539, 37528157, 37540408, 37547724, 37651614, 37665980, 37818983, 37822669, 37846543, 37887342, 38055673, 38079020, 38091354, 38141254, 38166900, 38217295, 38219188, 38354228, 39208202, 39327682, 39367019, 39367282, 39472976, 39474960, 39529389, 39596246, 39684714, 39684754, 39744679, 39779941, 40168606, 40227555, 40261557, 40346362, 40355925, 40462164, 40518661, 40611337	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18985363, 19228619, 19246647, 19378339, 19435942, 19636000, 19737147, 19755387, 19765000, 19818334, 20127344, 20131059, 20171178, 20304625, 20431032, 20473936, 20504876, 20510884, 20514489, 20560678, 20615753, 20661018, 20862485, 20926426, 20972461, 21045145, 21088844, 21119514, 21213123, 21301070, 21314850, 21344322, 21352804, 21382095, 21442241, 21465149, 21527585, 21554053, 21625441, 21781445, 21885076, 21910919, 21955197, 21955925, 22025148, 22040412, 22076165, 22080945, 22089350, 22136423, 22197544, 22298889, 22309944, 22322613, 22396072, 22399191, 22528790, 22547311, 22672415, 22688054, 22692287, 22736234, 22752145, 22752663, 22763442, 22785212, 22790483, 22805772, 22821382, 22869205, 22904127, 22922798, 22945948, 22992787, 23011765, 23063752, 23064941, 23079654, 23115158, 23184331, 23204232, 23209033, 23242283, 23250732, 23289977, 23291739, 23307057, 23361564, 23363074, 23373447, 23412777, 23429602, 23432648, 23438035, 23442355, 23541771, 23581583, 23595628, 23894344, 23904262, 23918605, 23934175, 23934769, 23955565, 23988086, 24019001, 24077277, 24129546, 24160898, 24252742, 24267971, 24305712, 24305719, 24366912, 24445767, 24460285, 24473683, 24473978, 24510240, 24614622, 24615357, 24706357, 24832620, 24876103, 24997139, 25008768, 25012071, 25054200, 25078896, 25150284, 25192052, 25233099, 25427834, 25429835, 25455102, 25486927, 25495392, 25511738, 25562199, 25605197, 25650121, 25681309, 25714433, 25732040, 25783747, 25790191, 25797251, 25849605, 25877892, 25943888, 25975377, 25980633, 26022161, 26045167, 26061751, 26091668, 26130305, 26158269, 26188014, 26190195, 26223576, 26308254, 26324126, 26354927, 26381180, 26405082, 26409566, 26427041, 26443480, 26485760, 26493382, 26503470, 26526944, 26603354, 26616112, 26757882, 26817999, 26860959, 26865311, 26934681, 26967252, 26975364, 27088883, 27158275, 27268645, 27270107, 27270908, 27406240, 27406953, 27409829, 27478330, 27503138, 27522495, 27526690, 27553586, 27573687, 27579614, 27626306, 27626492, 27638721, 27690648, 27764705, 27782828, 27820599, 27849434, 27923831, 27993946, 28073027, 28110298, 28148826, 28195901, 28214089, 28255664, 28278055, 28302331, 28330869, 28340142, 28401334, 28411277, 28421459, 28445981, 28467784, 28531337, 28564604, 28571041, 28574255, 28674742, 28675067, 28730141, 28755323, 28765916, 28789475, 28851427, 28869450, 28915860, 28928859, 28980701, 28988652, 29016947, 29016996, 29057925, 29115585, 29169920, 29212499, 29244145, 29255149, 29277589, 29302887, 29328863, 29372493, 29404978, 29423539, 29434344, 29453678, 29509313, 29548051, 29550762, 29556922, 29572492, 29610069, 29617848, 29625108, 29631562, 29662659, 29687495, 29693015, 29718366, 29719265, 29720725, 29721688, 29730791, 29741737, 29752851, 29753008, 29754968, 29775073, 29792149, 29809131, 29844869, 29878277, 29912767, 29920451, 29921698, 29982845, 30034612, 30152087, 30156013, 30187121, 30203362, 30220459, 30236994, 30249606, 30338243, 30401645, 30404651, 30426720, 30502793, 30508902, 30536544, 30659268, 30669568, 30710203, 30735871, 30738431, 30755240, 30773189, 30786920, 30848102, 30857299, 30878754, 30894629, 30927935, 30937703, 30948344, 30987226, 30989436, 30991024, 31034050, 31088577, 31108342, 31143523, 31159876, 31215469, 31250881, 31258744, 31271539, 31292202, 31371189, 31373686, 31388723, 31405148, 31422371, 31434323, 31435963, 31450822, 31479414, 31480372, 31504231, 31561044, 31591460, 31623593, 31623667, 31625205, 31632537, 31637414, 31667733, 31706351, 31727689, 31736002, 31746408, 31758617, 31766326, 31788085, 31829033, 31836442		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34716958	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18772396, 19117336, 19378339, 20127344, 20171178, 20304625, 20504876, 20560678, 20692206, 20862485, 20972461, 21045145, 21088844, 21119514, 21301070, 21352804, 21382095, 21442241, 21465149, 21527585, 21555372, 21885076, 21910919, 21955197, 22025148, 22040412, 22046342, 22076165, 22197544, 22298889, 22309944, 22322613, 22736234, 22752145, 22752663, 22904127, 22992787, 23011765, 23064941, 23079654, 23115158, 23184331, 23223340, 23250732, 23289977, 23291739, 23370430, 23412777, 23429602, 23438035, 23541771, 23581583, 23595628, 23904262, 23934175, 23934769, 23988086, 24019001, 24077277, 24089051, 24129546, 24264532, 24305712, 24305719, 24445767, 24473683, 24473978, 24510240, 24511544, 24614622, 24615357, 24706357, 24876103, 24997139, 25054200, 25150284, 25233099, 25415071, 25427834, 25429835, 25455102, 25486927, 25511738, 25562199, 25605197, 25650121, 25681309, 25714433, 25732040, 25783747, 25790191, 25849605, 25943888, 25976245, 26022161, 26045167, 26061751, 26091668, 26158269, 26190195, 26308254, 26354927, 26373279, 26381180, 26405082, 26409566, 26485760, 26493382, 26503470, 26616112, 26757882, 26817999, 26860959, 26865311, 26934681, 26935296, 26967252, 27088883, 27158275, 27270107, 27270908, 27406240, 27406953, 27409829, 27478330, 27522495, 27526690, 27573687, 27579614, 27593971, 27626306, 27626492, 27638721, 27690648, 27764705, 27782828, 27820599, 27923831, 27993946, 28110298, 28148826, 28195901, 28214089, 28278055, 28302331, 28401334, 28411277, 28421459, 28445981, 28467784, 28531337, 28564604, 28571041, 28574255, 28675067, 28730141, 28765916, 28789475, 28915860, 28928859, 28980701, 28988652, 29016947, 29016996, 29057925, 29115585, 29169920, 29212499, 29244145, 29255149, 29277589, 29302887, 29372493, 29404978, 29423539, 29434344, 29453678, 29509313, 29548051, 29572492, 29610069, 29617848, 29625108, 29631562, 29662659, 29687495, 29693015, 29718366, 29719265, 29720725, 29721688, 29730791, 29741737, 29754968, 29809131, 29844869, 29878277, 29920451, 29921698, 29982845, 29991527, 30034612, 30152087, 30156013, 30159779, 30187121, 30236994, 30338243, 30388142, 30401645, 30404651, 30426720, 30536544, 30669568, 30710203, 30728876, 30735871, 30738431, 30755240, 30773189, 30811476, 30848102, 30894197, 30894629, 30927935, 30937703, 30948344, 30987226, 30989436, 30991024, 31034050, 31108342, 31143523, 31159876, 31215469, 31250881, 31258744, 31271539, 31289510, 31356980, 31371189, 31373686, 31405148, 31422371, 31435963, 31450822, 31591460, 31632537, 31637414, 31667733, 31727689, 31736002, 31746408, 31758617, 31788085, 31829033, 31836442		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	18985363, 19117336, 19359588, 19378339, 19435942, 19554337, 19636000, 19765000, 19915484, 19996293, 20077503, 20127344, 20142433, 20160062, 20174854, 20427748, 20510884, 20661018, 20692206, 20805365, 20847279, 20862485, 20926426, 21080178, 21088844, 21129061, 21163902, 21194923, 21213123, 21289278, 21301070, 21314850, 21326614, 21352804, 21527585, 21554053, 21643985, 21690245, 21781445, 21829728, 21885076, 21913188, 21955197, 21971842, 21996744, 22002076, 22015945, 22025148, 22080945, 22113362, 22136423, 22166263, 22199315, 22238332, 22238333, 22291938, 22304788, 22309944, 22343889, 22360629, 22385606, 22385787, 22392125, 22396072, 22399191, 22426639, 22427879, 22445362, 22466620, 22528790, 22688054, 22692287, 22748659, 22790483, 22890969, 22904127, 22922798, 22922872, 22945948, 23011765, 23035067, 23072665, 23090985, 23109653, 23111198, 23115158, 23161787, 23184331, 23288644, 23307057, 23361564, 23370430, 23373447, 23373454, 23432648, 23442355, 23451940, 23494632, 23541771, 23595628, 23618424, 23681562, 23793099, 23796461, 23840696, 23877318, 23894344, 23934175, 23934769, 23954893, 24019001, 24068788, 24077805, 24077826, 24117486, 24305719, 24328868, 24362902, 24384677, 24473683, 24516018, 24528069, 24529257, 24531386, 24559763, 24590270, 24714777, 24722048, 24771584, 24832620, 24847087, 24857351, 24876103, 24880135, 24889502, 24895549, 24903073, 24922649, 24997139, 25005896, 25028501, 25035396, 25043048, 25078896, 25155243, 25185195, 25224277, 25225364, 25271760, 25283382, 25304134, 25324168, 25398843, 25471051, 25495392, 25496513, 25586175, 25604093, 25609060, 25678837, 25727224, 25783747, 25787993, 25853694, 25862748, 25867451, 25907263, 25921144, 25980633, 26061751, 26091668, 26109200, 26125858, 26130305, 26188014, 26220714, 26314843, 26324126, 26337623, 26338964, 26369702, 26405082, 26414224, 26485760, 26493382, 26524630, 26526944, 26538165, 26544771, 26558387, 26585387, 26586262, 26671986, 26700815, 26780338, 26819452, 26824661, 26834160, 26860959, 26936071, 26948345, 26967252, 27005468, 27036230, 27116977, 27120786, 27154922, 27245697, 27268645, 27282637, 27288434, 27337298, 27355333, 27401888, 27406953, 27430238, 27553586, 27568035, 27604789, 27608896, 27655638, 27664011, 27696222, 27820599, 27837434, 27840009, 27929688, 28004160, 28052098, 28110298, 28110346, 28148826, 28148827, 28178660, 28248126, 28251430, 28271343, 28293705, 28327577, 28353033, 28404805, 28427200, 28445981, 28465358, 28467784, 28468611, 28508328, 28547590, 28740449, 28748342, 28765641, 28869450, 28915660, 28915860, 28928859, 28980701, 29016996, 29062039, 29097607, 29115585, 29126125, 29172136, 29180699, 29258767, 29272522, 29288440, 29288860, 29290542, 29358170, 29414139, 29428975, 29453678, 29460007, 29460200, 29463646, 29485450, 29487977, 29490917, 29535392, 29545335, 29545476, 29550762, 29556922, 29562167, 29563135, 29564591, 29570009, 29625108, 29660019, 29662077, 29666413, 29671246, 29676036, 29719265, 29720725, 29721393, 29730475, 29761368, 29770897, 29777252, 29792149, 29885519, 29887919, 29953513, 30023167, 30034587, 30034612, 30152087, 30159860, 30184215, 30194745, 30209701, 30220459, 30249606, 30377558, 30386738, 30388142, 30414094, 30416682, 30457203, 30460631, 30511933, 30529899, 30560391, 30573870, 30596429, 30607877, 30611146, 30659268, 30713802, 30760578, 30777207, 30823903, 30857299, 30878893, 30927935, 30937703, 30943868, 30978442, 31014573, 31028664, 31041803, 31100523, 31102001, 31134296, 31143523, 31217295, 31222125, 31240524, 31278288, 31292202, 31324855, 31444316, 31485826, 31504231, 31548295, 31591460, 31606714, 31678207, 31701682, 31740784, 31745161, 31746408, 31768950, 31788085, 31824866, 31833906		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	LHGDN	19117336, 19228619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	19765000, 19935646, 20097881, 20133500, 20142433, 20171147, 20431032, 20603105, 20725730, 20805365, 20847279, 20926426, 21045145, 21075857, 21080253, 21163902, 21289278, 21301070, 21314850, 21326241, 21326614, 21343879, 21558404, 21717448, 21845536, 21996744, 22015945, 22025148, 22136423, 22215888, 22238332, 22238333, 22281806, 22343889, 22360629, 22385606, 22426639, 22427879, 22591444, 22785212, 22824796, 22844452, 22869205, 22885298, 22899282, 22922872, 22945948, 23041832, 23071355, 23072665, 23090983, 23109653, 23115158, 23161787, 23184331, 23236540, 23307057, 23361564, 23408861, 23410661, 23429363, 23429602, 23442355, 23456655, 23481705, 23486690, 23552385, 23592268, 23618424, 23630597, 23840696, 23918605, 23934175, 23934769, 24068788, 24077277, 24098815, 24149775, 24160898, 24305719, 24460285, 24470545, 24511544, 24516018, 24529257, 24531386, 24559763, 24590270, 24722048, 24760710, 24771584, 24832620, 24847087, 24860178, 24877111, 24889502, 24903073, 24958096, 24970694, 25012071, 25028501, 25081751, 25243911, 25257301, 25283382, 25304134, 25376594, 25407774, 25427834, 25496513, 25674227, 25701198, 25706986, 25783747, 25811801, 25862748, 25908561, 25921144, 25962792, 26061751, 26061753, 26091668, 26125858, 26175411, 26181761, 26190195, 26210286, 26280302, 26314843, 26316565, 26324126, 26338964, 26369702, 26405082, 26485760, 26524630, 26534967, 26538165, 26558387, 26617880, 26618343, 26669865, 26681766, 26686626, 26691210, 26699864, 26700815, 26824661, 26834160, 26859452, 26901439, 26918938, 26922345, 26936071, 26967252, 27036230, 27116977, 27120786, 27144334, 27145078, 27154922, 27245697, 27268645, 27282637, 27300198, 27311324, 27337298, 27353503, 27401888, 27427385, 27430238, 27437179, 27468718, 27529619, 27568035, 27576872, 27608896, 27624942, 27655638, 27716832, 27820599, 27834917, 27840009, 27852048, 27880937, 28052098, 28122345, 28160566, 28178660, 28201752, 28202508, 28223536, 28248126, 28253929, 28255664, 28327577, 28330869, 28339588, 28340142, 28360267, 28371827, 28392842, 28403884, 28450436, 28467784, 28531337, 28532485, 28561706, 28575485, 28705010, 28710497, 28714279, 28823044, 28833542, 28851427, 28869450, 28915860, 28916733, 28945860, 29016839, 29016871, 29016996, 29040662, 29042619, 29074637, 29077933, 29122763, 29126125, 29133704, 29167275, 29220731, 29272522, 29303363, 29368212, 29396294, 29428975, 29438510, 29440182, 29453678, 29454261, 29460007, 29463646, 29490917, 29519794, 29535392, 29545335, 29545476, 29550880, 29556922, 29562167, 29572636, 29590424, 29631562, 29650441, 29662077, 29663171, 29666413, 29676036, 29718398, 29733378, 29741737, 29748206, 29752851, 29762717, 29764444, 29770368, 29792149, 29794476, 29846705, 29846902, 29874711, 29887919, 29923492, 29953478, 29991527, 29994582, 30006485, 30027617, 30107597, 30115812, 30152087, 30170631, 30190259, 30190592, 30220459, 30222900, 30249606, 30257451, 30277274, 30277427, 30297697, 30346624, 30397180, 30404651, 30496526, 30504574, 30536195, 30548945, 30558073, 30573870, 30624711, 30661193, 30668823, 30675060, 30705071, 30719536, 30760837, 30777895, 30809977, 30861589, 30864101, 30894197, 30912613, 30926639, 30943868, 31023364, 31028664, 31038238, 31066901, 31127834, 31134296, 31141785, 31175415, 31208797, 31222125, 31248860, 31251406, 31278288, 31290679, 31292202, 31353322, 31413006, 31444316, 31533980, 31545245, 31623593, 31637414, 31637430, 31665443, 31690770, 31706351, 31745161, 31746408, 31748746, 31754769, 31768950, 31806013, 31832685, 31833906, 31868291, 31869219, 31870275, 31881020, 31889117, 31889470, 31909698, 31957551, 31960234, 31984581, 32064507, 32107555, 32111869, 32146731, 32166314, 32218467, 32228694, 32280672, 32328652, 32382048, 32386320, 32412186, 32434559, 32462389, 32484805, 32503220, 32530764, 32559177, 32563269, 32606138, 32631306, 32643682, 32646946, 32681084, 32687065, 32706862, 32710757, 32716208, 32725165, 32727476, 32748499, 32856857, 32882013, 32888020, 32929644, 32932560, 32946483, 32949176, 32964017, 33002860, 33009979, 33017591, 33028081, 33059718, 33062706, 33077924, 33096928, 33120918, 33121211, 33130858, 33163535, 33167941, 33168106, 33169458, 33173941, 33198677, 33206320, 33216206, 33216326, 33228806, 33244057, 33244787, 33246490, 33247679, 33282092, 33299387, 33342816, 33363544, 33408717, 33414227, 33417137, 33472598, 33493139, 33498463, 33509914, 33538917, 33553421, 33575999, 33622884, 33632416, 33658560, 33686953, 33691798, 33772213, 33778723, 33783067, 33823014, 33846339, 33854822, 33892666, 33900414, 33940787, 33941250, 33963441, 33969682, 33980169, 34016731, 34049406, 34065652, 34078652, 34078827, 34088969, 34115146, 34121368, 34159191, 34162262, 34173871, 34186176, 34205437, 34214170, 34257334, 34332627, 34333454, 34377594, 34389754, 34424450, 34440884, 34490493, 34496929, 34507430, 34525976, 34573317, 34589661, 34594037, 34594038, 34597382, 34603319, 34609036, 34618597, 34653254, 34657400, 34685506, 34753441, 34767259, 34792037, 34863298, 34902368, 34905094, 34911188, 34941573, 34952640, 34988580, 34992215, 34994387, 35027006, 35029738, 35058510, 35124175, 35144680, 35157758, 35173295, 35212929, 35217778, 35262523, 35264242, 35287169, 35341001, 35361262, 35362874, 35387222, 35398668, 35406793, 35416795, 35452002, 35454365, 35488516, 35511748, 35526267, 35532193, 35550063, 35563134, 35581287, 35590222, 35604410, 35610333, 35615769, 35615996, 35621655, 35628596, 35639513, 35649412, 35672531, 35682718, 35695190, 35701666, 35713257, 35722822, 35738587, 35743228, 35806337, 35816267, 35852388, 35856894, 35864624, 35864633, 35866817, 35878398, 35882906, 35931979, 35972438, 35991838, 35994777, 35996504, 36011350, 36029398, 36031351, 36043552, 36053463, 36076905, 36112301, 36159801, 36176070, 36180241, 36181110, 36239925, 36248907, 36258151, 36290809, 36329288, 36335158, 36335201, 36348001, 36350001, 36360312, 36361838, 36377597, 36399711, 36400017, 36411356, 36434176, 36434487, 36471242, 36471244, 36510639, 36565986, 36571817, 36580017, 36584682, 36587030, 36597096, 36598613, 36637205, 36647288, 36647700, 36648487, 36652918, 36653382, 36690887, 36692427, 36739454, 36823302, 36826993, 36837615, 36847506, 36916606, 36932446, 36941703, 36959422, 36964277, 36974551, 37029174, 37032198, 37055795, 37076313, 37094238, 37100086, 37104042, 37105678, 37118755, 37162029, 37166058, 37185361, 37185778, 37218937, 37219717, 37271257, 37343523, 37354775, 37372972, 37374260, 37382607, 37468750, 37470575, 37474126, 37528157, 37556350, 37574201, 37580817, 37619597, 37651309, 37652542, 37733671, 37738033, 37870293, 37883975, 37884300, 37891325, 37910594, 37918583, 37934582, 37952042, 37980651, 38069019, 38091354, 38109891, 38134061, 38167551, 38168519, 38203783, 38217295, 38243318, 38253989, 38267516, 38272925, 38433527, 38554294, 38579726, 39189437, 39208202, 39272024, 39285364, 39367019, 39382765, 39385311, 39454886, 39474970, 39596246, 39732457, 39840558, 40090418, 40100522, 40127071, 40157017, 40171868, 40197845, 40214613, 40261557, 40302099, 40358804, 40420017, 40457320, 40480654, 40513058, 40560010, 40569935, 40597255, 40611337, 40627394, 40640380, 40643554, 40682696, 40690204	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	CTD_human_DG	19901110, 25391653, 25848751, 26618343, 28122345		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	UNIPROT_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	CGI_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
gliosarcoma	Gliosarcoma	ORPHANET_DG	18772396		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gliosarcoma	Gliosarcoma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
gliosarcoma	Gliosarcoma	BEFREE	21955926, 22270848, 27153165, 28789475, 31829033		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gliosarcoma	Gliosarcoma	Pubtator	23041832, 23324827	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	31637414, 33244787, 33692446	Associate	★☆☆☆☆ Found in Text Mining only
Grade I Astrocytoma	Grade I Astrocytoma	BEFREE	23934769		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32948843	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	22057234, 23485734, 26123062, 26508204, 28544751, 29744569		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	CTD_human_DG	22057234		★☆☆☆☆ Found in Text Mining only
Hemangioma, Intramuscular	Hemangioma	CTD_human_DG	22057234		★☆☆☆☆ Found in Text Mining only
Hemangiomatosis	Hemangiomatosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	20538800, 21539821, 21997850, 24760710, 25040794, 27005468, 27591990, 28193778, 28315358, 28403884, 29064021, 29670690, 30577887, 31841594		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	24760710, 27505668, 30577887, 31841594, 32716208, 33493392, 37774069	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	20946881		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	24376688		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	36321611	Associate	★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	30325321		★☆☆☆☆ Found in Text Mining only
Histiocytoid hemangioma	Epithelioid hemangioma	CTD_human_DG	22057234		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	27611087		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	27611087, 29068569	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30354812		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22106302, 22442146, 24986863, 26538165, 29846705, 31066901, 35682718, 36344581, 40640380	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	21083371		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27848136		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	25029120, 29788391		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	27553586, 31096221		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	28943155		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	22824796, 24185509, 24406866, 24478380, 24867389, 24880135, 25043045, 25485496, 26189129, 26245674, 26717940, 26819452, 27231123, 27259014, 27595804, 27622582, 27864835, 28403884, 28431889, 28567120, 28628842, 29274619, 29353494, 29408647, 30156013, 30170977, 30278918, 30615206, 30849962, 30889491, 31121195, 31186529, 31255945, 31300360, 31476489		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	CTD_human_DG	24185509		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	29661250		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	22046342		★☆☆☆☆ Found in Text Mining only
L2 Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	22674224		★☆☆☆☆ Found in Text Mining only
Leishmaniasis Cutaneous	Leishmaniasis	Pubtator	31957551	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20171147, 21523797, 21912393, 22385606, 22397365, 23071355, 23996483, 25398940, 26943899, 28076841, 28653623, 29272522, 29472349, 31208797, 32272438, 32634241, 33609081, 33972549, 34440884, 34857894, 35743098, 35938721, 35973983, 36222845, 36952395	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20702649, 21690245, 22343896, 22968464, 23801749, 23999441, 25398939, 25895133, 27063596, 27292784, 28193778, 28561042, 31208797		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	21080253, 21346257, 22162831, 22360629, 22824796, 27575502	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19657110, 20097881, 20142433, 20171147, 20368543, 20494930, 20538800, 20651067, 20678218, 20805365, 21045145, 21130701, 21173122, 21504050, 21596848, 21873548, 21881046, 21889610, 22020636, 22215888, 22385606, 22397365, 22535592, 22737091, 22809434, 22885298, 22912701, 22929312, 23074281, 23184331, 23365461, 23641016, 23996483, 24082129, 24142997, 24333121, 24376688, 24531386, 24565682, 24590270, 24606448, 24760710, 24887327, 24986689, 25022553, 25252869, 25398940, 25599133, 25601757, 25651001, 25932436, 25987093, 26016821, 26234722, 26331834, 26375248, 26466372, 26486081, 26943899, 27245312, 27460089, 27568819, 27575502, 27577048, 27992414, 28039446, 28074068, 28403884, 28653623, 29272522, 29274134, 29339439, 29472349, 29860938, 29988143, 30171025, 30249606, 30366412, 30422308, 30862724, 30988238, 31085507, 31145495, 31155409, 31348835, 31685963, 31727977, 31768950, 31835432, 31841594, 31869219, 31910380, 32212799, 32272438, 32393603, 32461631, 32476595, 32634241, 32733012, 32882760, 32948843, 33119202, 33119479, 33255417, 33368799, 33493392, 33592582, 33822485, 33832922, 33840625, 33860275, 33881523, 33941203, 33972549, 33976256, 34001134, 34153064, 34602526, 34750086, 34794176, 34873300, 34946913, 35046058, 35166065, 35273342, 35345371, 35381077, 35460975, 35526267, 35732498, 35790845, 35797463, 35973983, 36054614, 36064577, 36107670, 36222845, 36308802, 36335201, 36355448, 36411356, 36793248, 36815747, 36847506, 36881031, 36991512, 37267439, 37458189, 37459200, 37478088, 37495775, 37774069, 37882467, 38010220, 38019014, 39475462, 40058648	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	21828135, 26331834	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	22397365, 24565682, 29274134, 36815747	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CLINVAR_DG	19657110, 20946881, 22160010, 22397365, 22417203, 22898539, 24606448, 26619011		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20097881, 20142433, 20171147, 20376086, 20410924, 20494930, 20538800, 20567020, 20625116, 20651067, 20692206, 20805365, 20946881, 20962328, 21045145, 21130701, 21173122, 21251613, 21294161, 21316759, 21527585, 21539821, 21576631, 21598255, 21647152, 21647154, 21873548, 21881046, 21889610, 21997850, 22020636, 22071137, 22172803, 22215888, 22323113, 22397365, 22430270, 22488406, 22494415, 22616558, 22809434, 22917530, 22929312, 23039322, 23074281, 23111200, 23135354, 23184331, 23365461, 23632886, 23645565, 23782684, 23863747, 23949315, 23949914, 23954893, 23982740, 23996483, 24065765, 24082129, 24333121, 24344214, 24376688, 24443894, 24531386, 24590270, 24606448, 24699305, 24880135, 24887327, 24986689, 24995286, 25022553, 25398940, 25486927, 25523507, 25599133, 25601757, 25651001, 25795706, 25891481, 25891904, 25987093, 26007236, 26016821, 26111463, 26189213, 26234722, 26436839, 26466372, 26508204, 26553750, 26582645, 26819452, 26834160, 26943899, 26951332, 27005468, 27245312, 27577048, 27721426, 27735988, 27956631, 28039446, 28074068, 28193778, 28232670, 28286924, 28345823, 28663574, 28735489, 28735490, 28735491, 29064021, 29090344, 29156201, 29181548, 29274134, 29339439, 29439493, 29472349, 29522955, 29543066, 29635257, 29860938, 29882807, 29988143, 30122995, 30171025, 30209701, 30249606, 30366412, 30422308, 30643428, 30692099, 30728456, 30861214, 30862724, 30984620, 30988238, 31085507, 31145495, 31155409, 31192118, 31348835, 31586149, 31592861, 31632056, 31685963, 31836442, 31841594, 31848884		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	25324972, 27992414		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	19340432, 29077933		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	21472284		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24531386, 25081338, 25355558, 28403884, 28739529, 29776636, 31017316		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	35001007	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	27466707	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28297679, 28739529		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	28297679	Associate	★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	33493392	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	20603105	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31888670, 32167618, 34145795, 35526267, 35732498	Associate	★☆☆☆☆ Found in Text Mining only
Lymphangioma	Lymphangioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21996744		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	Pubtator	21996744, 25398940, 33735913	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma Follicular	Lymphoma	Pubtator	40358804	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	20946881		★☆☆☆☆ Found in Text Mining only
Maffucci Syndrome	Maffucci Syndrome	BEFREE	22057234, 22057236, 24403254, 26473790, 26508204, 27036230, 28544751, 28845532, 29339836, 30579273, 30977938		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Maffucci Syndrome	Maffucci Syndrome	GENOMICS_ENGLAND_DG	22057234, 22057236		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Maffucci Syndrome	Maffucci Syndrome	ORPHANET_DG	22057234, 22057236		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Maffucci Syndrome	Maffucci Syndrome	CTD_human_DG	22057234, 22057236		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Maffucci syndrome	Maffucci Syndrome	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Malformations of Cortical Development	Cortical development malformation	Pubtator	34587990	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	28552826		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	19228619, 19935646, 20102524, 20725730, 22136423, 22821382, 22869205, 23619925, 23934175, 24160898, 24559763, 24929863, 25164322, 25224277, 25304134, 25471051, 26308254, 26316565, 26338964, 26618343, 27153165, 27576872, 27982759, 29288860, 29444314, 30244386, 30511933, 30738431, 31153561, 31175415		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	19901110, 25391653, 25848751, 26618343, 28122345		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	19935646, 20160062, 22015945, 29089260, 29290542, 29703472, 29849122, 30412573		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29661250		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29921847		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	28567120, 31122820, 31476489		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	27655638		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	26680004		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25043045		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29723602, 30305430		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31110157		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28652247		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19378339, 25024164, 29331887, 29427004, 31068457, 31090082, 31846689		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29610475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31068366		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	20171178, 21527585, 21996744		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19117336, 19935646, 20160062, 20692206, 20972461, 21119514, 21284999, 21326614, 21527585, 21555372, 21996744, 22180306, 22442146, 22688054, 22772731, 22805772, 22885298, 22945948, 22980977, 23071355, 23204232, 23235339, 23540690, 23630074, 23681227, 23731180, 23877318, 24077826, 24098815, 24220273, 24366912, 24478380, 24589777, 24670968, 24699305, 24760710, 24986863, 24995286, 25043045, 25271760, 25391653, 25398940, 25678837, 25787993, 25795706, 25877892, 25956465, 26041263, 26111463, 26243269, 26363012, 26368816, 26538165, 26562302, 26585387, 26678339, 26819452, 26856236, 26943899, 26957363, 27005468, 27116977, 27175787, 27231123, 27354064, 27355333, 27406240, 27430238, 27466707, 27505668, 27608896, 27624942, 27649069, 27819678, 27923831, 27982681, 28132785, 28232670, 28273642, 28315358, 28373671, 28402860, 28564604, 28601826, 28652247, 28711227, 28986582, 29077933, 29097607, 29137396, 29180699, 29249359, 29290542, 29320744, 29331887, 29367755, 29382206, 29427004, 29458964, 29522955, 29537891, 29651790, 29703472, 29723602, 29738972, 29792149, 29805076, 29844869, 29849122, 29879375, 29921847, 29950729, 29970880, 30003571, 30194083, 30206411, 30209701, 30266754, 30266764, 30355724, 30720071, 30755816, 30759236, 30903027, 30958073, 30991024, 31010244, 31054900, 31068366, 31250881, 31420939, 31451215, 31548295, 31727977		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21996744, 31505989		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	CLINVAR_DG	26619011		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Medulloblastoma	Medulloblastoma	BEFREE	29582271		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Medulloblastoma	Medulloblastoma	Pubtator	36400017, 36941703, 40627836	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
melanoma	Melanoma	BEFREE	20603105, 21356389, 22980977, 23235339, 26049021, 30003571, 30639360		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22980977, 31980996	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	36828361, 37528722	Associate	★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	18344044		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	23117877		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	31020875		★☆☆☆☆ Found in Text Mining only
Micromelia	Micromelia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	24286310	Associate	★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	19901110, 25391653, 25848751, 26618343, 28122345		★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	BEFREE	22844452		★☆☆☆☆ Found in Text Mining only
Mixed oligoastrocytoma	Oligoastrocytoma	BEFREE	27704386		★☆☆☆☆ Found in Text Mining only
Mixed Oligodendroglioma-Astrocytoma	Mixed Oligodendroglioma-Astrocytoma	CTD_human_DG	20160062		★☆☆☆☆ Found in Text Mining only
Mixed Oligodendroglioma-Astrocytoma	Mixed Oligodendroglioma-Astrocytoma	BEFREE	21075857, 22385787, 22978341, 24519516, 26276726, 26303387, 28419269		★☆☆☆☆ Found in Text Mining only
Mixed Oligodendroglioma-Ependymoma	Mixed Oligodendroglioma-Ependymoma	CTD_human_DG	20160062		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	22385606	Associate	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis III	Mucopolysaccharidosis	Pubtator	24614622	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	29884741	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29970342		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	35217778	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	24903747		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	20494930, 20946881, 21523797, 21576631, 21997850, 22033490, 23394086, 23645565, 23996483, 24115220, 24376688, 24903747, 24936872, 25486927, 25836588, 26486081, 27005468, 27721426, 28873367, 29549529, 29599340, 29635257, 29791902, 30632174, 31592861		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	20494930, 20678218, 21523797, 23996483, 24115220, 24376688, 25836588, 26331834, 26486081, 27992414, 29472349, 31208955, 33275703, 33275714, 33730109, 35273342, 35938721, 36815747, 38640348	Associate	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	29181548		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	21080253, 25029120		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	20538800, 21346257, 23543457		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	20508616, 23954893, 24376688, 25486927		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	22025148, 23451042, 25407774, 26405082, 29687258, 30190259, 33002860	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19117336, 19228619, 19359588, 19435942, 19554337, 19636000, 19737147, 19798509, 19903171, 19996293, 20102524, 20160062, 20427748, 20473936, 20538800, 20603105, 20725730, 20975057, 21163902, 21225914, 21251613, 21289278, 21301070, 21314850, 21356389, 21516462, 21523797, 21531791, 21532524, 21552114, 21554053, 21558404, 21569770, 21643985, 21647885, 21898821, 21913188, 21914791, 21929658, 21937911, 21955197, 21996744, 22020830, 22039037, 22040412, 22046342, 22057234, 22057236, 22064513, 22076165, 22080945, 22136423, 22144470, 22162831, 22166263, 22180306, 22197544, 22199315, 22217666, 22231405, 22238333, 22322613, 22360629, 22385787, 22392125, 22399191, 22415316, 22445362, 22447191, 22692287, 22736234, 22790483, 22821382, 22844452, 22885298, 22886134, 22892521, 22899282, 22922798, 22945948, 22997168, 23015095, 23035067, 23038259, 23053495, 23072665, 23090985, 23096133, 23111198, 23117877, 23161787, 23184331, 23209033, 23232569, 23235339, 23242283, 23269986, 23307057, 23361564, 23393090, 23393205, 23410661, 23412777, 23485467, 23494632, 23512379, 23581583, 23595628, 23598960, 23680144, 23764841, 23782684, 23817809, 23826216, 23877318, 23894344, 23909061, 24077805, 24077826, 24089051, 24150401, 24162810, 24184969, 24252742, 24305712, 24305719, 24328865, 24366912, 24384677, 24470545, 24478380, 24511544, 24516018, 24589777, 24599602, 24607494, 24614622, 24615357, 24680178, 24760710, 24771584, 24777756, 24810474, 24832620, 24847087, 24857351, 24868540, 24876103, 24952577, 24986863, 24995286, 25005896, 25012071, 25029120, 25043045, 25043048, 25048629, 25135281, 25155243, 25170661, 25173140, 25205290, 25225364, 25283382, 25318355, 25324168, 25415071, 25432631, 25485496, 25511738, 25524848, 25537428, 25648859, 25664944, 25674227, 25694352, 25730874, 25779854, 25783747, 25797251, 25836588, 25849605, 25853694, 25877892, 25895133, 25934342, 25980580, 26006098, 26046462, 26091668, 26118895, 26124478, 26125858, 26147657, 26161668, 26243269, 26260902, 26276726, 26314843, 26316565, 26337623, 26352098, 26354927, 26373279, 26381180, 26404554, 26405082, 26409566, 26457357, 26473790, 26524630, 26538165, 26544771, 26585387, 26616112, 26617922, 26669865, 26757882, 26817999, 26819452, 26834160, 26860959, 26918938, 26936071, 26951332, 27005468, 27036230, 27088883, 27270908, 27282637, 27300198, 27367599, 27401154, 27406953, 27425854, 27437179, 27466707, 27468718, 27469217, 27522495, 27564467, 27568035, 27576872, 27593971, 27626306, 27626492, 27664011, 27738332, 27780605, 27790861, 27819678, 27848136, 27849434, 27929688, 27935156, 27978414, 28039367, 28084339, 28110298, 28122345, 28148826, 28148827, 28178660, 28214089, 28236063, 28248126, 28251430, 28255664, 28263929, 28293705, 28319047, 28319049, 28327577, 28340142, 28353033, 28377251, 28421459, 28432450, 28465358, 28481241, 28497806, 28531337, 28552826, 28564603, 28569381, 28578659, 28601826, 28640702, 28740449, 28748342, 28751246, 28869450, 28922847, 28945795, 28980701, 28988652, 29026176, 29027701, 29042619, 29054837, 29057925, 29071695, 29084603, 29137285, 29169920, 29180699, 29186201, 29218432, 29245920, 29255149, 29274619, 29302887, 29339439, 29346478, 29366652, 29404978, 29423539, 29428975, 29439493, 29485450, 29502292, 29519794, 29535392, 29548051, 29550880, 29564591, 29582271, 29596354, 29600313, 29635257, 29643764, 29662077, 29662659, 29666413, 29670690, 29676036, 29676695, 29687258, 29738972, 29741737, 29743236, 29761369, 29762717, 29847930, 29860714, 29914429, 29936695, 29941484, 29953478, 29953513, 30023167, 30034612, 30072066, 30073642, 30079885, 30113684, 30131249, 30153799, 30159860, 30206411, 30249606, 30263090, 30266754, 30278918, 30292978, 30296521, 30298540, 30333046, 30355724, 30381394, 30391048, 30414094, 30414095, 30416682, 30460631, 30467813, 30504574, 30536195, 30575118, 30607877, 30641835, 30759236, 30760578, 30862724, 30874903, 30878754, 30878893, 30916536, 30991024, 31005161, 31022510, 31039139, 31054099, 31058968, 31066901, 31110157, 31114362, 31121195, 31143523, 31153561, 31160331, 31240473, 31257503, 31444316, 31479414, 31504231, 31518680, 31609487, 31621885, 31623667, 31637414, 31667733, 31670750, 31677487, 31701682, 31807171		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	19435942		★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	BEFREE	27780605		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	32729927	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	22892521, 29138945, 29196927, 30963251		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	9566392		★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	22772608		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22064513, 23235339, 30305430		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	29661250		★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	40597877	Associate	★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	19554337, 25962792, 26485760, 26918938, 28945860, 30276676, 31984581, 32228694, 32856872, 34440884	Associate	★☆☆☆☆ Found in Text Mining only
Oligodendroblastoma	Oligodendroblastoma	CTD_human_DG	20160062		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	18985363, 19228619, 19246647, 19554337, 19737147, 19765000, 19915484, 19996293, 21069360, 21233669, 21470325, 21532524, 21558404, 21643842, 21898821, 21937591, 22072542, 22385787, 22396073, 22528790, 22718548, 22913971, 22992787, 23082883, 23209033, 23373454, 23432648, 23909061, 23934175, 24252742, 24444336, 25277207, 25694352, 25853694, 26210286, 26243269, 26276726, 26354927, 26493382, 26757882, 26960282, 27311324, 27389560, 27556304, 27704386, 27780605, 27791984, 27806376, 28042970, 28327577, 28547590, 28748342, 28851427, 28915860, 28987669, 29027701, 29077933, 29186201, 29224049, 29468261, 29631562, 29663171, 29693015, 30206763, 30292978, 30536195, 30710203, 31058967, 31371189, 31508376, 31714292		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
oligodendroglioma	Oligodendroglioma	LHGDN	18985363		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Oligodendroglioma	Oligodendroglioma	Pubtator	19246647, 19554337, 19744125, 19765000, 21558404, 21631627, 21937591, 22072542, 23071531, 23481705, 23486687, 24149775, 24353325, 24460285, 24722048, 25277207, 25427834, 25694352, 26068201, 26125858, 26493382, 27268645, 27311324, 27543943, 27556304, 27651340, 27806376, 28126746, 28255664, 28360267, 28388591, 28392842, 28474187, 29077933, 29569163, 29631562, 29663171, 29890994, 30536195, 30635340, 30705071, 31248444, 31248860, 31561286, 31727977, 31832685, 32025725, 32025728, 32599896, 32690110, 32854646, 32859823, 33214617, 33361717, 33367753, 33622884, 33772213, 33899270, 34020723, 34162262, 34587990, 34767259, 34967922, 35157758, 35287169, 35287567, 35511748, 35522558, 35604410, 35615769, 35994777, 35996504, 36181110, 36258151, 36350001, 36510639, 36525723, 36613601, 37185778, 37219717, 37574201, 37603235, 37665980, 37883975, 37884300, 37919784, 38141254, 39259414, 40159303, 40358804, 40597255	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
oligodendroglioma	Oligodendroglioma	CTD_human_DG	20160062		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Oligodendroglioma	Oligodendroglioma	Pubtator	28915860	Stimulate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ollier disease	Ollier Disease	Orphanet			★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21558404	Associate	★☆☆☆☆ Found in Text Mining only
Osteochondroma	Osteochondroma	Pubtator	35660795	Associate	★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 3	Osteogenesis imperfecta	Pubtator	25701198, 29887919, 30635340, 33622884	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37645416	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	20459648, 24898068, 26161668, 36601689	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23598960, 24403254, 26161668, 28534992		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31110157		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31110157, 33649794, 37324278	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28652247		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27466707		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27466707, 33755158, 35681100	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	20702649		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	19915015, 29846902		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	29846902	Associate	★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	30362515		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	21558404	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	25486927		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	27466707		★☆☆☆☆ Found in Text Mining only
Peripheral demyelinating neuropathy	Demyelinating neuropathy	BEFREE	9566392		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	26617922		★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	BEFREE	23896377		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	25766404		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	29846902, 30050099	Associate	★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	19543740, 19667985, 22617234, 23370430, 23934769, 24057326, 24532263, 26115961, 26617931, 26824661, 27791984, 28468611, 30963251, 31677487		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	26473790	Associate	★☆☆☆☆ Found in Text Mining only
Pleomorphic Xanthoastrocytoma	Pleomorphic Xanthoastrocytoma	BEFREE	26414224, 27253461, 29532523, 29859360, 30051528		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	38243290	Stimulate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	20508616, 21904853, 22106054, 27447873, 29515238		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	20508616, 27447873	Associate	★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	HPO_DG			★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	20538800, 21647154, 28544751		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	22674224		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	15065742		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	29610069		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	20410924, 20508616, 21904853, 23619563, 25252869, 27447873, 28948488, 29181548		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25024164, 29331887, 29427004, 31068457, 31090082, 31846689		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23071355, 25024164, 26544944, 27819678, 28031426, 31068457, 36828361	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29610475		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31570703	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal carcinoma	Renal Carcinoma	BEFREE	26680004		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	24077277, 28548125		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	31462501	Associate	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	19554337, 23236540, 24958096, 25283629, 31984581, 32228694, 32856857	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22779686, 31836442		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	23071355, 34994649	Associate	★☆☆☆☆ Found in Text Mining only
Sclerosis	Sclerosis	Pubtator	33495182	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	25252869, 27992414, 30848394		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	22217666, 24324372, 24903073, 29490917, 30558073, 31141785, 31556015, 33206320, 33846339, 36258151, 36877775, 37104042	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	24386123	Associate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	33963001	Associate	★☆☆☆☆ Found in Text Mining only
Sinonasal undifferentiated carcinoma	Sinonasal undifferentiated carcinoma	BEFREE	30206411		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29599340		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	24286310	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28672945		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	21598255		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22064513		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27863386		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36063222, 39256086	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31068366		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25656989, 34145795	Associate	★☆☆☆☆ Found in Text Mining only
Supratentorial Neoplasms	Supratentorial Neoplasm	BEFREE	22311105		★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	24160898, 25962792, 29752851	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	29599340, 30632174		★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	29545335	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	20508616, 28218607	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	20508616, 21904853, 22106054, 27447873		★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	20171178	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	20171178, 20702649, 21527585, 21996744, 23414134		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	20171178	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	20171178, 20702649, 21527585, 21996744		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	20171178, 21996744, 22824796, 23071355, 23414134, 32737449, 37864896	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30189722		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30189722	Associate	★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	HPO_DG			★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	33216206, 34848827	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	25029120, 27063727		★☆☆☆☆ Found in Text Mining only
Unconjugated hyperbilirubinemia	Hyperbilirubinemia	BEFREE	28588020, 30013764		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	28084339, 29683816		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34964002	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	27155448, 30008023		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	30008023	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	22057234	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	29676036	Inhibit	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	33361259, 37100086	Associate	★☆☆☆☆ Found in Text Mining only
Visceral angiomatosis	Visceral angiomatosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vulvar Lichen Sclerosus	Vulvar Lichen Sclerosus	BEFREE	24164308		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	18985363, 19228619, 19246647, 19554337, 19737147, 19765000, 19915484, 19996293, 21069360, 21233669, 21470325, 21532524, 21558404, 21643842, 21898821, 21937591, 22072542, 22385787, 22396073, 22528790, 22718548, 22913971, 22992787, 23082883, 23209033, 23373454, 23432648, 23909061, 23934175, 24252742, 24444336, 25277207, 25694352, 25853694, 26210286, 26243269, 26276726, 26354927, 26493382, 26757882, 26960282, 27311324, 27389560, 27556304, 27704386, 27780605, 27791984, 27806376, 28042970, 28327577, 28547590, 28748342, 28851427, 28915860, 28987669, 29027701, 29077933, 29186201, 29224049, 29468261, 29631562, 29663171, 29693015, 30206763, 30292978, 30536195, 30710203, 31058967, 31371189, 31508376, 31714292		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	CTD_human_DG	20160062		★☆☆☆☆ Found in Text Mining only