ID2B (inhibitor of DNA binding 2B (pseudogene))
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 84099 |
| Gene name | Inhibitor of DNA binding 2B (pseudogene) |
| Gene symbol | ID2B |
| Synonyms (NCBI Gene) |
-
|
| Chromosome | 3 |
| Chromosome location | 3p14.2 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q14602 |
| Protein name | Putative DNA-binding protein inhibitor ID-2B (Inhibitor of DNA binding 2B) |
| Family and domains | |
| Sequence |
MKAFSPVRSIRKNSLLDHRLGISQSKTPVDDLMSLL |
| Sequence length | 36 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with ID2B across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to ID2B (see Related Genes above), that are NOT already directly curated for ID2B itself -- a lead worth checking, not a confirmed association.
0
|
|