Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	3383
Gene name	Intercellular adhesion molecule 1
Gene symbol	ICAM1
Synonyms (NCBI Gene)	BB2CD54P3.58
Chromosome	19
Chromosome location	19p13.2
Summary	This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. [provided by Ref

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs5491	A>G,T	Risk-factor	Coding sequence variant, missense variant

581

Show/Hide all (581)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004430	hsa-miR-221-3p	Luciferase reporter assayWestern blot	20110463
MIRT004430	hsa-miR-221-3p	Luciferase reporter assayWestern blot	20110463
MIRT004595	hsa-miR-222-3p	Review	20144731
MIRT004596	hsa-miR-339-5p	Review	20144731
MIRT004020	hsa-miR-17-3p	ImmunocytochemistryNorthern blotqRT-PCRWestern blot	19949084
MIRT005707	hsa-miR-31-5p	Luciferase reporter assay	19949084
MIRT005708	hsa-miR-17-5p	Luciferase reporter assay	19949084
MIRT005709	hsa-miR-155-5p	Luciferase reporter assay	19949084
MIRT004430	hsa-miR-221-3p	Luciferase reporter assay	19949084
MIRT004595	hsa-miR-222-3p	Luciferase reporter assay	19949084
MIRT005710	hsa-miR-1256	Luciferase reporter assay	19949084
MIRT005952	hsa-miR-21-5p	Luciferase reporter assayMicroarrayqRT-PCR	21131358
MIRT018131	hsa-miR-335-5p	Microarray	18185580
MIRT005709	hsa-miR-155-5p	qRT-PCR	21310411
MIRT027615	hsa-miR-98-5p	Microarray	19088304
MIRT054757	hsa-miR-146a-5p	QRTPCRWestern blot	24867582
MIRT438044	hsa-miR-324-3p	qRT-PCR	24367666
MIRT438035	hsa-miR-93-5p	qRT-PCR	24367666
MIRT438044	hsa-miR-324-3p	qRT-PCR	24367666
MIRT438035	hsa-miR-93-5p	qRT-PCR	24367666
MIRT611897	hsa-miR-8485	HITS-CLIP	19536157
MIRT611896	hsa-miR-329-3p	HITS-CLIP	19536157
MIRT611895	hsa-miR-362-3p	HITS-CLIP	19536157
MIRT611894	hsa-miR-603	HITS-CLIP	19536157
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	19536157
MIRT611888	hsa-miR-1255a	HITS-CLIP	19536157
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	19536157
MIRT611886	hsa-miR-3941	HITS-CLIP	19536157
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611891	hsa-miR-3975	HITS-CLIP	23824327
MIRT611890	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT611889	hsa-miR-3188	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT635764	hsa-miR-4643	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT635763	hsa-miR-466	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611891	hsa-miR-3975	HITS-CLIP	23824327
MIRT611890	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT149142	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT149176	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT611889	hsa-miR-3188	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611891	hsa-miR-3975	HITS-CLIP	23824327
MIRT611890	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT149142	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT149176	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT611889	hsa-miR-3188	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT727476	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT727474	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT727475	hsa-miR-32-5p	HITS-CLIP	22473208
MIRT004020	hsa-miR-17-3p	Luciferase reporter assay	26935986
MIRT004020	hsa-miR-17-3p	Luciferase reporter assay	26935986
MIRT004020	hsa-miR-17-3p	Luciferase reporter assayWestern blot	26935986
MIRT004020	hsa-miR-17-3p	Luciferase reporter assayWestern blot	26935986
MIRT004430	hsa-miR-221-3p	Luciferase reporter assay	28338009
MIRT004595	hsa-miR-222-3p	Luciferase reporter assay	28338009
MIRT734212	hsa-miR-223-3p	ELISAFlow cytometryImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blotting	33637123
MIRT736710	hsa-miR-29a-3p	Luciferase reporter assayWestern blottingqRT-PCR	31538414
MIRT611897	hsa-miR-8485	HITS-CLIP	19536157
MIRT611896	hsa-miR-329-3p	HITS-CLIP	19536157
MIRT611895	hsa-miR-362-3p	HITS-CLIP	19536157
MIRT611894	hsa-miR-603	HITS-CLIP	19536157
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	19536157
MIRT611888	hsa-miR-1255a	HITS-CLIP	19536157
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	19536157
MIRT611886	hsa-miR-3941	HITS-CLIP	19536157
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611891	hsa-miR-3975	HITS-CLIP	23824327
MIRT611890	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT611889	hsa-miR-3188	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT635764	hsa-miR-4643	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT635763	hsa-miR-466	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611891	hsa-miR-3975	HITS-CLIP	23824327
MIRT611890	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT149142	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT149176	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT611889	hsa-miR-3188	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT611897	hsa-miR-8485	HITS-CLIP	23824327
MIRT611896	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT611895	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT611894	hsa-miR-603	HITS-CLIP	23824327
MIRT611893	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT611892	hsa-miR-3186-3p	HITS-CLIP	23824327
MIRT611891	hsa-miR-3975	HITS-CLIP	23824327
MIRT611890	hsa-miR-2467-5p	HITS-CLIP	23824327
MIRT149142	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT149176	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT611889	hsa-miR-3188	HITS-CLIP	23824327
MIRT611888	hsa-miR-1255a	HITS-CLIP	23824327
MIRT611887	hsa-miR-1255b-5p	HITS-CLIP	23824327
MIRT611886	hsa-miR-3941	HITS-CLIP	23824327
MIRT755509	hsa-miR-26a-5p	qRT-PCR	35681518
MIRT755531	hsa-miR-149-3p	qRT-PCR	36250208
MIRT1058518	hsa-miR-1225-3p	CLIP-seq
MIRT1058519	hsa-miR-1233	CLIP-seq
MIRT1058520	hsa-miR-1237	CLIP-seq
MIRT1058521	hsa-miR-1248	CLIP-seq
MIRT1058522	hsa-miR-1255b	CLIP-seq
MIRT1058523	hsa-miR-1262	CLIP-seq
MIRT1058524	hsa-miR-2110	CLIP-seq
MIRT1058525	hsa-miR-2355-5p	CLIP-seq
MIRT1058526	hsa-miR-25	CLIP-seq
MIRT1058527	hsa-miR-3127-3p	CLIP-seq
MIRT1058528	hsa-miR-3153	CLIP-seq
MIRT1058529	hsa-miR-32	CLIP-seq
MIRT1058530	hsa-miR-3200-3p	CLIP-seq
MIRT1058531	hsa-miR-328	CLIP-seq
MIRT1058532	hsa-miR-329	CLIP-seq
MIRT1058533	hsa-miR-34b	CLIP-seq
MIRT1058534	hsa-miR-3614-5p	CLIP-seq
MIRT1058535	hsa-miR-363	CLIP-seq
MIRT1058536	hsa-miR-3664-3p	CLIP-seq
MIRT1058537	hsa-miR-367	CLIP-seq
MIRT1058538	hsa-miR-3689a-3p	CLIP-seq
MIRT1058539	hsa-miR-3689c	CLIP-seq
MIRT1058540	hsa-miR-3929	CLIP-seq
MIRT1058541	hsa-miR-4271	CLIP-seq
MIRT1058542	hsa-miR-4281	CLIP-seq
MIRT1058543	hsa-miR-4286	CLIP-seq
MIRT1058544	hsa-miR-4299	CLIP-seq
MIRT1058545	hsa-miR-4313	CLIP-seq
MIRT1058546	hsa-miR-4314	CLIP-seq
MIRT1058547	hsa-miR-4419b	CLIP-seq
MIRT1058548	hsa-miR-4433	CLIP-seq
MIRT1058549	hsa-miR-4459	CLIP-seq
MIRT1058550	hsa-miR-4478	CLIP-seq
MIRT1058551	hsa-miR-4667-5p	CLIP-seq
MIRT1058552	hsa-miR-4695-5p	CLIP-seq
MIRT1058553	hsa-miR-4700-5p	CLIP-seq
MIRT1058554	hsa-miR-4701-3p	CLIP-seq
MIRT1058555	hsa-miR-4725-3p	CLIP-seq
MIRT1058556	hsa-miR-4728-5p	CLIP-seq
MIRT1058557	hsa-miR-4768-3p	CLIP-seq
MIRT1058558	hsa-miR-4793-3p	CLIP-seq
MIRT1058559	hsa-miR-483-3p	CLIP-seq
MIRT1058560	hsa-miR-508-5p	CLIP-seq
MIRT1058561	hsa-miR-510	CLIP-seq
MIRT1058562	hsa-miR-512-5p	CLIP-seq
MIRT1058563	hsa-miR-542-3p	CLIP-seq
MIRT1058564	hsa-miR-548c-3p	CLIP-seq
MIRT1058565	hsa-miR-619	CLIP-seq
MIRT1058566	hsa-miR-637	CLIP-seq
MIRT1058567	hsa-miR-661	CLIP-seq
MIRT1058568	hsa-miR-766	CLIP-seq
MIRT1058569	hsa-miR-767-5p	CLIP-seq
MIRT1058570	hsa-miR-92a	CLIP-seq
MIRT1058571	hsa-miR-92b	CLIP-seq
MIRT1058526	hsa-miR-25	CLIP-seq
MIRT1058529	hsa-miR-32	CLIP-seq
MIRT1058534	hsa-miR-3614-5p	CLIP-seq
MIRT1058535	hsa-miR-363	CLIP-seq
MIRT1058536	hsa-miR-3664-3p	CLIP-seq
MIRT1058537	hsa-miR-367	CLIP-seq
MIRT1058538	hsa-miR-3689a-3p	CLIP-seq
MIRT1058539	hsa-miR-3689c	CLIP-seq
MIRT1058540	hsa-miR-3929	CLIP-seq
MIRT1058542	hsa-miR-4281	CLIP-seq
MIRT1058547	hsa-miR-4419b	CLIP-seq
MIRT1058548	hsa-miR-4433	CLIP-seq
MIRT1058549	hsa-miR-4459	CLIP-seq
MIRT1058550	hsa-miR-4478	CLIP-seq
MIRT1058552	hsa-miR-4695-5p	CLIP-seq
MIRT1058556	hsa-miR-4728-5p	CLIP-seq
MIRT1058557	hsa-miR-4768-3p	CLIP-seq
MIRT1058561	hsa-miR-510	CLIP-seq
MIRT1058562	hsa-miR-512-5p	CLIP-seq
MIRT1058569	hsa-miR-767-5p	CLIP-seq
MIRT1058570	hsa-miR-92a	CLIP-seq
MIRT1058571	hsa-miR-92b	CLIP-seq
MIRT1058518	hsa-miR-1225-3p	CLIP-seq
MIRT1058519	hsa-miR-1233	CLIP-seq
MIRT1058534	hsa-miR-3614-5p	CLIP-seq
MIRT1058536	hsa-miR-3664-3p	CLIP-seq
MIRT1058538	hsa-miR-3689a-3p	CLIP-seq
MIRT1058539	hsa-miR-3689c	CLIP-seq
MIRT1058540	hsa-miR-3929	CLIP-seq
MIRT1058542	hsa-miR-4281	CLIP-seq
MIRT1058547	hsa-miR-4419b	CLIP-seq
MIRT1058548	hsa-miR-4433	CLIP-seq
MIRT1058549	hsa-miR-4459	CLIP-seq
MIRT1058550	hsa-miR-4478	CLIP-seq
MIRT1058552	hsa-miR-4695-5p	CLIP-seq
MIRT1058556	hsa-miR-4728-5p	CLIP-seq
MIRT1058557	hsa-miR-4768-3p	CLIP-seq
MIRT1058561	hsa-miR-510	CLIP-seq
MIRT1058562	hsa-miR-512-5p	CLIP-seq
MIRT1058518	hsa-miR-1225-3p	CLIP-seq
MIRT1058519	hsa-miR-1233	CLIP-seq
MIRT1058534	hsa-miR-3614-5p	CLIP-seq
MIRT1058536	hsa-miR-3664-3p	CLIP-seq
MIRT1058538	hsa-miR-3689a-3p	CLIP-seq
MIRT1058539	hsa-miR-3689c	CLIP-seq
MIRT1058540	hsa-miR-3929	CLIP-seq
MIRT1058542	hsa-miR-4281	CLIP-seq
MIRT1058547	hsa-miR-4419b	CLIP-seq
MIRT1058548	hsa-miR-4433	CLIP-seq
MIRT1058549	hsa-miR-4459	CLIP-seq
MIRT1058550	hsa-miR-4478	CLIP-seq
MIRT1058552	hsa-miR-4695-5p	CLIP-seq
MIRT1058556	hsa-miR-4728-5p	CLIP-seq
MIRT1058557	hsa-miR-4768-3p	CLIP-seq
MIRT1058561	hsa-miR-510	CLIP-seq
MIRT1058562	hsa-miR-512-5p	CLIP-seq
MIRT2429716	hsa-miR-1285	CLIP-seq
MIRT2429717	hsa-miR-1299	CLIP-seq
MIRT2429718	hsa-miR-130a	CLIP-seq
MIRT2429719	hsa-miR-130b	CLIP-seq
MIRT2429720	hsa-miR-203	CLIP-seq
MIRT2429721	hsa-miR-301a	CLIP-seq
MIRT2429722	hsa-miR-301b	CLIP-seq
MIRT2429723	hsa-miR-3148	CLIP-seq
MIRT2429724	hsa-miR-3187-5p	CLIP-seq
MIRT2429725	hsa-miR-326	CLIP-seq
MIRT2429726	hsa-miR-330-5p	CLIP-seq
MIRT2429727	hsa-miR-3666	CLIP-seq
MIRT2429728	hsa-miR-378g	CLIP-seq
MIRT2429729	hsa-miR-3910	CLIP-seq
MIRT2429730	hsa-miR-3945	CLIP-seq
MIRT2429731	hsa-miR-409-3p	CLIP-seq
MIRT2429732	hsa-miR-4253	CLIP-seq
MIRT2429733	hsa-miR-4295	CLIP-seq
MIRT2429734	hsa-miR-4436a	CLIP-seq
MIRT2429735	hsa-miR-4453	CLIP-seq
MIRT2429736	hsa-miR-4486	CLIP-seq
MIRT2429737	hsa-miR-4538	CLIP-seq
MIRT2429738	hsa-miR-454	CLIP-seq
MIRT2429739	hsa-miR-4671-3p	CLIP-seq
MIRT2429740	hsa-miR-4700-3p	CLIP-seq
MIRT2429741	hsa-miR-4737	CLIP-seq
MIRT2429742	hsa-miR-593	CLIP-seq
MIRT2429743	hsa-miR-612	CLIP-seq
MIRT2429744	hsa-miR-635	CLIP-seq
MIRT2429745	hsa-miR-875-3p	CLIP-seq
MIRT2437675	hsa-miR-2861	CLIP-seq
MIRT2437676	hsa-miR-4265	CLIP-seq
MIRT2437677	hsa-miR-4296	CLIP-seq
MIRT2437678	hsa-miR-4322	CLIP-seq
MIRT2437679	hsa-miR-4417	CLIP-seq
MIRT2437680	hsa-miR-4800-3p	CLIP-seq
MIRT2437681	hsa-miR-595	CLIP-seq
MIRT2437682	hsa-miR-873	CLIP-seq
MIRT2437675	hsa-miR-2861	CLIP-seq
MIRT2437676	hsa-miR-4265	CLIP-seq
MIRT2437677	hsa-miR-4296	CLIP-seq
MIRT2437678	hsa-miR-4322	CLIP-seq
MIRT2437679	hsa-miR-4417	CLIP-seq
MIRT2437680	hsa-miR-4800-3p	CLIP-seq
MIRT2437681	hsa-miR-595	CLIP-seq
MIRT2442261	hsa-miR-599	CLIP-seq
MIRT2437682	hsa-miR-873	CLIP-seq
MIRT2548894	hsa-miR-1205	CLIP-seq
MIRT1058522	hsa-miR-1255b	CLIP-seq
MIRT2429716	hsa-miR-1285	CLIP-seq
MIRT2548895	hsa-miR-1286	CLIP-seq
MIRT2548896	hsa-miR-1289	CLIP-seq
MIRT2548897	hsa-miR-1291	CLIP-seq
MIRT2429717	hsa-miR-1299	CLIP-seq
MIRT2429718	hsa-miR-130a	CLIP-seq
MIRT2429719	hsa-miR-130b	CLIP-seq
MIRT2548898	hsa-miR-146b-3p	CLIP-seq
MIRT2548899	hsa-miR-153	CLIP-seq
MIRT2548900	hsa-miR-2115	CLIP-seq
MIRT1058525	hsa-miR-2355-5p	CLIP-seq
MIRT2429721	hsa-miR-301a	CLIP-seq
MIRT2429722	hsa-miR-301b	CLIP-seq
MIRT1058527	hsa-miR-3127-3p	CLIP-seq
MIRT2429723	hsa-miR-3148	CLIP-seq
MIRT2429724	hsa-miR-3187-5p	CLIP-seq
MIRT2548901	hsa-miR-3192	CLIP-seq
MIRT1058530	hsa-miR-3200-3p	CLIP-seq
MIRT2548902	hsa-miR-320a	CLIP-seq
MIRT2548903	hsa-miR-320b	CLIP-seq
MIRT2548904	hsa-miR-320c	CLIP-seq
MIRT2548905	hsa-miR-320d	CLIP-seq
MIRT2548906	hsa-miR-320e	CLIP-seq
MIRT2548907	hsa-miR-323b-3p	CLIP-seq
MIRT2429725	hsa-miR-326	CLIP-seq
MIRT1058531	hsa-miR-328	CLIP-seq
MIRT2429726	hsa-miR-330-5p	CLIP-seq
MIRT2429727	hsa-miR-3666	CLIP-seq
MIRT1058538	hsa-miR-3689a-3p	CLIP-seq
MIRT1058539	hsa-miR-3689c	CLIP-seq
MIRT2429728	hsa-miR-378g	CLIP-seq
MIRT2429731	hsa-miR-409-3p	CLIP-seq
MIRT1058543	hsa-miR-4286	CLIP-seq
MIRT2429733	hsa-miR-4295	CLIP-seq
MIRT1058545	hsa-miR-4313	CLIP-seq
MIRT2548908	hsa-miR-4327	CLIP-seq
MIRT2548909	hsa-miR-4418	CLIP-seq
MIRT2548910	hsa-miR-4419a	CLIP-seq
MIRT2548911	hsa-miR-4429	CLIP-seq
MIRT2548912	hsa-miR-4449	CLIP-seq
MIRT2429736	hsa-miR-4486	CLIP-seq
MIRT2548913	hsa-miR-4493	CLIP-seq
MIRT2548914	hsa-miR-4496	CLIP-seq
MIRT2548915	hsa-miR-4510	CLIP-seq
MIRT2548916	hsa-miR-4532	CLIP-seq
MIRT2429738	hsa-miR-454	CLIP-seq
MIRT2548917	hsa-miR-4633-3p	CLIP-seq
MIRT2429739	hsa-miR-4671-3p	CLIP-seq
MIRT2548918	hsa-miR-4691-5p	CLIP-seq
MIRT2548919	hsa-miR-4715-3p	CLIP-seq
MIRT2548920	hsa-miR-4722-5p	CLIP-seq
MIRT2548921	hsa-miR-4725-5p	CLIP-seq
MIRT1058556	hsa-miR-4728-5p	CLIP-seq
MIRT2429741	hsa-miR-4737	CLIP-seq
MIRT2548922	hsa-miR-4738-3p	CLIP-seq
MIRT2548923	hsa-miR-4747-5p	CLIP-seq
MIRT2548924	hsa-miR-504	CLIP-seq
MIRT2548925	hsa-miR-509-3-5p	CLIP-seq
MIRT2548926	hsa-miR-509-5p	CLIP-seq
MIRT2548927	hsa-miR-558	CLIP-seq
MIRT2429742	hsa-miR-593	CLIP-seq
MIRT2429743	hsa-miR-612	CLIP-seq
MIRT2429745	hsa-miR-875-3p	CLIP-seq
MIRT2548897	hsa-miR-1291	CLIP-seq
MIRT2429717	hsa-miR-1299	CLIP-seq
MIRT2548898	hsa-miR-146b-3p	CLIP-seq
MIRT2429725	hsa-miR-326	CLIP-seq
MIRT2429726	hsa-miR-330-5p	CLIP-seq
MIRT2429731	hsa-miR-409-3p	CLIP-seq
MIRT2548912	hsa-miR-4449	CLIP-seq
MIRT2548913	hsa-miR-4493	CLIP-seq
MIRT2548916	hsa-miR-4532	CLIP-seq
MIRT2548919	hsa-miR-4715-3p	CLIP-seq
MIRT2429741	hsa-miR-4737	CLIP-seq
MIRT2548923	hsa-miR-4747-5p	CLIP-seq
MIRT2429742	hsa-miR-593	CLIP-seq
MIRT2429745	hsa-miR-875-3p	CLIP-seq

Show/Hide all (23)

Transcription factor	Regulation	Reference
CEBPA	Unknown	9916895
ERG	Repression	22235125
ETS2	Activation	9572487
ETV5	Activation	9572487
HDAC1	Activation	12490396
IFI16	Repression	17699163
MYB	Repression	21953443
NFATC1	Activation	19351910
NFKB1	Activation	10092659;10946302;11463837;11877286;16317091;16385502;17121934;19074768;20173029;22001597;22708120;9733827;9916895
NFKB1	Unknown	10738944;10837365;10926553;11198351;11401521;12490396;12691701;15480988;15800027;15843586;16105834;16453001;18285351;18928584;20103608;9192770
NFKBIA	Repression	12490396;9733827;9990039
PPARG	Repression	17425601
RARA	Activation	1355009
RARG	Activation	1355009
REL	Unknown	10706725;10837365;10926553
RELA	Activation	10092659;10946302;11463837;11877286;16317091;16385502;17121934;19074768;19351910;20173029;22001597;22708120;9733827;9888295;9916895
RELA	Unknown	10228026;10837365;10926553;11401521;12490396;12691701;15800027;15843586;16105834;16453001;18285351;18928584;20103608;9192770
SIRT1	Repression	23238746
SP1	Unknown	15480988
STAT1	Activation	12651068;9888295;9990314
STAT3	Unknown	23690481;8675499
TWIST1	Activation	17487558
TWIST2	Activation	17487558

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0001772	Component	Immunological synapse	IEA
GO:0001910	Process	Regulation of leukocyte mediated cytotoxicity	TAS	16038038
GO:0002252	Process	Immune effector process	IEA
GO:0002291	Process	T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IMP	2477710
GO:0002457	Process	T cell antigen processing and presentation	IEA
GO:0002693	Process	Positive regulation of cellular extravasation	IMP	12902516
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	2538243
GO:0005178	Function	Integrin binding	IBA
GO:0005178	Function	Integrin binding	IDA	23620790
GO:0005178	Function	Integrin binding	IEA
GO:0005178	Function	Integrin binding	IPI	1448173, 12208882
GO:0005515	Function	Protein binding	IPI	7822297, 12526797, 12716892, 16595626, 22956999, 23858057, 28514442, 32296183, 32814053, 33961781
GO:0005615	Component	Extracellular space	IDA	9290466
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	NAS	3349522
GO:0005886	Component	Plasma membrane	TAS	2538243
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006955	Process	Immune response	IEA
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IDA	16809613
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	TAS	2477710
GO:0007159	Process	Leukocyte cell-cell adhesion	IEA
GO:0007159	Process	Leukocyte cell-cell adhesion	IEA
GO:0007159	Process	Leukocyte cell-cell adhesion	IMP	2477710
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	HDA	19581412, 23981064
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0022614	Process	Membrane to membrane docking	IEP	12082081
GO:0031012	Component	Extracellular matrix	HDA	27559042
GO:0033627	Process	Cell adhesion mediated by integrin	IEA
GO:0038023	Function	Signaling receptor activity	TAS	2538243
GO:0044406	Process	Adhesion of symbiont to host	IDA	2538243
GO:0045121	Component	Membrane raft	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0046813	Process	Receptor-mediated virion attachment to host cell	IDA	2538243
GO:0050900	Process	Leukocyte migration	IEA
GO:0050900	Process	Leukocyte migration	IEP	12082081
GO:0061028	Process	Establishment of endothelial barrier	IGI	23264465
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0070062	Component	Extracellular exosome	IDA	21276792
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	10903502
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0072683	Process	T cell extravasation	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:1900027	Process	Regulation of ruffle assembly	IEA
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	10903502
GO:1904646	Process	Cellular response to amyloid-beta	IDA	11078691
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	10903502

MIM	HGNC	e!Ensembl
147840	5344	ENSG00000090339

P05362

Protein name

Intercellular adhesion molecule 1 (ICAM-1) (Major group rhinovirus receptor) (CD antigen CD54)

Protein function

ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activati

PDB

1D3E , 1D3I , 1D3L , 1IAM , 1IC1 , 1MQ8 , 1P53 , 1Z7Z , 2OZ4 , 3TCX , 5MZA , 6EIT , 6S8U , 7BG7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03921	ICAM_N	24 → 115	Intercellular adhesion molecule (ICAM), N-terminal domain	Domain

Sequence

MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGI
ETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHH
GANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLD
GLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQE
TLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
IVIITVVAAAVIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP

Sequence length

532

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (54)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERIOSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY ATRESIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES, TRAUMATIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL HYPERREACTIVITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIECTASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR ACCIDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE OPHTHALMOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES OPHTHALMOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKIN DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERCHOLESTEROLEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ICAM1-related disorder	Likely benign; Benign; risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malaria, cerebral, susceptibility to	Benign; risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malaria, susceptibility to	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHIC OPHTHALMOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY DISEASE, CHRONIC OBSTRUCTIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UREMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URTICARIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (806)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
ABCD syndrome	Abcd syndrome	Pubtator	39182041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Achondroplasia	Achondroplasia	Pubtator	12823344	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	CTD_human_DG	20083630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	11922919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Inflammatory Demyelinating Polyneuropathy	Inflammatory Demyelinating Polyneuropathy	BEFREE	27460017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	1356935, 29575872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	10090411, 31059081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	17704297, 18055984, 29055789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	LHGDN	17704297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11720474, 16497620, 7519825, 9486621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	21396625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22248682, 29207489, 30606988, 7657294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	9057191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	1356935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	16152613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11321434, 1356935, 28110427, 31315993, 8920885, 9209305, 9219058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	16604055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander disease	Pubtator	9797554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	15196284, 23053371, 23472126, 29278941, 29967928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	8721483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	LHGDN	12624779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	8721483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	7554406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20110602, 33720880	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21942811, 22272623, 25197660, 29343717, 38167125, 38178159, 7904796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	18322020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	Pubtator	25178329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	29025766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	11469468, 28468674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	LHGDN	17397790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	10807794, 24551209	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	12034693, 32777069, 9371854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	31672902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm, Dissecting	Aortic Aneurysm	BEFREE	16636253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Pectoris	Angina pectoris	Pubtator	26078712	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	10475771	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	37298547	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	10475771, 15704532, 15757077, 20940515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	18848929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	37014642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	37914735	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	7955542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	11854734, 12928630, 7955542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	21436157, 30354818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	30529828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	23053371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	28798776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial Occlusive Disease	BEFREE	11854734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	11854734	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11225735, 12192299, 15682683, 15711569, 15736117, 16276035, 17276892, 17962597, 18420209, 19874473, 20592751, 21090717, 21392767, 22648254, 22762513 View all (33 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteritis	Arteritis	Pubtator	1712368	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	12808331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	24665114, 29548992, 30488167, 7866347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	11310827, 1702929, 31864394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10447928, 11083275, 12417058, 12632416, 12746897, 1352152, 15756053, 16385502, 17009243, 17359498, 19597294, 23632129, 30071898, 31652652, 31812161, 32674360, 8536370, 9099936, 9691097 View all (4 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12296865	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	33424834, 37958839, 39379962	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	10092659, 10885418, 18446055, 25003170, 30339462, 32348692, 33122732, 36197221, 7512004, 7525343, 7545095, 9625753	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	10835320, 11496238, 12122108, 16625213, 24393359, 25003170, 30339462, 31814717, 7542080, 7613226, 9731032		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	15059493, 15548573, 16021473, 16625213		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	CTD_human_DG	17014439, 25003170		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	38373824	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	10438951, 12222834, 14615040, 17012252, 19306055, 19357230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	17012252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	19357230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	24252689	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10892347, 11805151, 15704532, 17089918, 18057581, 18420209, 19332210, 20360547, 20940515, 21496279, 22648254, 24942509, 25003524, 25310099, 26078712 View all (12 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	11225735, 12192299, 15682683, 15711569, 15736117, 16276035, 17276892, 17962597, 18420209, 19874473, 20592751, 21090717, 21392767, 22648254, 22762513 View all (32 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	12677255		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	1372160, 15711569	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	15548573, 15682683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	18375832		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	18375832	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrophy	Atrophy	Pubtator	11737595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	39481220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	11936473, 12100759, 14643123, 27595159, 29675623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	17112530, 27706780, 7526029, 7705360, 7903279, 8721479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	28388873, 28413469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	30704307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19966855, 22508288, 28178884, 29201232, 29207118, 30577642, 30688264, 31065990, 8599446		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10520003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	24474251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	24474251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	27363029	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	10333719, 17056573	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	BEFREE	10792421, 11409120, 12808331, 16680245, 19906207, 24645721, 27894415		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	CTD_human_DG	12074830, 8712863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	12808331, 24136464	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	LHGDN	12918698		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Neoplasm	Benign Neoplasm	BEFREE	21879273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	14606706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	16097065		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Atresia	Biliary Atresia	LHGDN	18401716		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Atresia	Biliary atresia	Pubtator	7519822, 9149337	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary cirrhosis	Biliary cirrhosis	LHGDN	16038038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	12783123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21725879, 28355551, 31164632, 31273010, 9392053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	1974471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	15287939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	34503477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	34879826	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	8604395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	11028443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Abscess	Brain Abscess	BEFREE	26943967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	31849969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	10898423, 15067196	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	17394460, 19417757		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	10417770, 24289603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	24289603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	24289603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14572152, 15774488, 16320110, 17219382, 18256929, 18474291, 20459645, 21223991, 21590495, 23079714, 25972323, 26299331, 26751847, 26872904, 27207667 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10880401, 20459645, 21590495, 22791584, 23337791, 24566270, 25202046, 26299331, 28367091, 29498809, 30082828, 36373309, 36788602, 40230289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11761443	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	CTD_human_DG	17014439		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiectasis	Bronchiectasis	Pubtator	11106214, 17931847	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiectasis	Bronchiectasis	CTD_human_DG	17931847		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiolitis	Bronchiolitis	LHGDN	15221034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	8915211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Sequestration	Bronchopulmonary Disease	BEFREE	17973899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	LHGDN	15009098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	1309680, 1372880, 27655016, 31587870, 7836923, 9172810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	1691936, 27655016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	2898508	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	9763568	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Capillary malformation (disorder)	Capillary malformation	BEFREE	12774035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22562265, 24069166, 24789429, 26265203, 32466535, 33462208, 35887223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35473775	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	2654024, 9495363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	21980389, 22664550, 24789429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15053044, 24614035, 26109813, 26341495, 33462208, 34696675, 34869770, 7927492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35473775	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	7992839	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	29808366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21725879, 28355551, 31164632, 31273010, 9392053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	1680858, 17361014, 17786042, 21328467, 22198381, 22248682, 25118107, 29148014, 29348824, 30573629, 8880099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	31312656	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17607380, 21068256, 25973014, 31850854, 35449452, 36353618, 7622256, 7905278, 7913877, 8099898, 9620222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26943029	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16412062	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	21980389, 22664550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19389515, 23933413, 25659662, 25793777, 25879517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	23555914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	36936778, 8563121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	11823084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	12095649, 12192299, 12637697, 12939654, 15345506, 15682683, 17677000, 17962597, 22124782, 22609477, 22808171, 25575156, 28122514, 28202840, 28371087 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	CTD_human_DG	16332659, 25575156		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17640650		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	20191078, 22808171, 24083591, 25575156, 25784313, 30653588, 31629408, 33050491, 36012132	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27527002	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carotid Artery Diseases	Carotid artery disease	LHGDN	14993495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	27090396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	27090396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	25441669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	15380042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	22763828, 37131205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	1490146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	12941768, 16916657, 16916660, 18703101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	LHGDN	16916657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	1972610, 27406562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	35833818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	12095649, 12637697, 31595195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	LHGDN	12509902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	17089918, 20360547, 20622166, 31183363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	12637697, 24785937, 28509283, 29399739, 30392400, 31147725		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	LHGDN	12637697, 15952122		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular accident	Stroke	CTD_human_DG	20083630		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	10892347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	12095649, 29096697		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	9159342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	9790391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	1356935, 21606482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	16021473, 24393359, 25003170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	7537707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	LHGDN	15123348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	21224055		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chondrosarcoma	Chondrosarcoma	Pubtator	12587980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	21391218, 22644863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	1430258, 15711569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	33246119	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 3	Kidney Disease	BEFREE	31370809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	22609477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	26408929, 28122514, 29804241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10520003, 12068792, 19009294, 20122733, 29156691, 7519509, 8093369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	11953106, 16611655		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	25411435, 26747783, 28056984, 29329563, 9817722		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Periodontitis	Periodontitis	BEFREE	22230463, 27391418, 7525481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	22230463, 27391418, 7525481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	29367682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	7523818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic venous insufficiency	Venous Insufficiency	BEFREE	10086854, 8609252		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	21606482, 26943967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cohen syndrome	Cohen Syndrome	BEFREE	30843084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	12477764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	11923606, 23717571	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	12477764, 36860851, 38065859, 7902311	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15334673, 16497620, 16920698, 18084318, 25622900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11169447, 11761438, 7902311	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15334673		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	16497620, 7902311		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16051479, 16920698, 16937502, 19822019, 23098564, 28495508, 28757355, 28816939, 30470940, 31308754, 31511625, 9495363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	11956618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15053044, 15334673, 16920698, 16937502, 18084316, 18084318, 19822019, 23098564, 24720439, 25532000, 27764803, 28105922, 28816939, 29105339, 29188362 View all (10 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	1395097	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	10477731, 28949989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	16097065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	20636398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1A	Congenital disorder of glycosylation	Pubtator	27415628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1s	Congenital disorder of glycosylation	BEFREE	28777499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of adrenal gland	Congenital adrenal hypoplasia	BEFREE	29284752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital hypothyroidism	Pubtator	8099855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31729904, 31778438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective tissue disease	Pubtator	10209523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19360351, 25973014, 7521786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal Diseases	BEFREE	27035623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	19482023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal neovascularization	Pubtator	19531249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	31783796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12127369, 15379751, 19048183, 19169973, 19564823, 21987404, 24993975, 25025994, 25310099, 25503951, 26078712, 26371161, 29316562, 30290609, 31072912, 31783796, 8701848, 9670921 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	11250042, 12127369, 16043164, 19048183, 19169973, 19564823, 21987404, 24993975, 25025994, 25503951, 26078712, 29130961, 29316562, 30290609, 30961613, 31072912, 31783796, 8701848 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	12940514, 16043164, 19169973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	14695458, 20628522, 25890092	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	17263916, 18057581, 19876414, 21169918, 22780915, 25310099, 26078712, 30961613, 31783796, 36928188, 8969030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	18057581, 20940515, 22388798, 31072912, 32770617, 34850451, 34861059, 34873417, 39344313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	28796044	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	11250042, 12127369, 19048183, 19169973, 19564823, 21987404, 22203486, 24993975, 25025994, 25503951, 26078712, 28796044, 29316562, 30290609, 30674642, 31072912, 31783796, 8701848 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	21169918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	10732847	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	LHGDN	14695458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	14695458, 25310099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11313303, 11726228, 12077088, 15290909, 15958080, 16497620, 16741608, 17593226, 22900953, 25942347, 7615193, 9609749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	11923606, 23717571, 7541009	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	12477764, 15958080, 18647548, 28400196, 7902311, 8537050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	15290909, 17593226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	7900941	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	28028722, 28228404, 30703475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	16313300, 16432463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyclical vomiting syndrome (disorder)	Cyclical Vomiting Syndrome	BEFREE	28682429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	28821422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	12403695, 21659660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	LHGDN	17328035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	17328035, 26185364	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	30582899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10090156, 10447928, 12632416, 15934126, 22119941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	21172429, 26289958, 30054439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	12095649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	24435747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28564681, 30035700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	10086854	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	15654951, 20065994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	7616001	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Allergic Contact	Allergic contact dermatitis	Pubtator	2574536, 9155652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	15370698, 9160089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Contact	Contact dermatitis	Pubtator	10504443, 1706746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	30132823, 31806958, 8884526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	27889748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	8800304, 9099932	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28772214, 30327716, 30994864, 31280040, 31330062, 9833936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	10540181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	35046894	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	1385478, 15031178, 16978373, 18604267, 21533024, 25287126, 28920516, 7545873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	18473826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	25303153, 28576439, 28772214, 29974394, 30327716, 30798334, 30994864, 31280040, 31330062, 9833936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	10540181, 1675200, 16978373, 18505543, 19995711, 2498883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	22763828, 31629408	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27090396, 32176024, 34991588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10773353, 10902613, 11132145, 14643123, 16978373, 18045485, 26122942, 27246625, 28611472, 30587209, 30777937, 30798334, 9833936		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	16358956		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	11935152, 12027924, 12207164		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12027924, 15736117, 16759306, 17089918, 17704300, 18942221, 22588952, 24612665, 26255081, 26717491, 26872904, 27090396, 27323139, 29228585, 30219475 View all (10 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	24513509		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	9833936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	32176024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	16978373, 18505543, 33506255, 36949528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	16978373, 18505543, 23922864, 26255081, 29123394, 29201232, 29223351, 30355913, 30587209, 30632070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	18505543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	CTD_human_DG	10485912		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	12027924, 16759306, 18942221, 19482023, 19587357, 23922864, 24612665, 25324196, 26717491, 26988565, 28104396, 28138697, 28351645, 30419874, 30662833, 31109934 View all (1 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	12027924, 15666579, 18942221		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	19531249, 34010297	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Astrocytoma	Astrocytoma	BEFREE	19306055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	14557478, 16538446, 17873320, 27906544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorders of Sex Development	Disorders of sex development	Pubtator	33422029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	11678899, 27293319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	22050548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	27906544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia, Familial	Dysautonomia	BEFREE	28457935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	30132823, 30783420, 8884526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	2574536, 8609251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	31239476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	25306249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	21172429, 29871779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	37644514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	15212674, 9872366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	11716965, 11963839, 12529420, 15212674, 16938116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	11937115, 14505752, 16759923, 27614631, 35616875, 9848307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	12529420, 15212674, 16938116, 19661147, 20160446, 20422421, 25859827, 27614631, 28333208, 29924731, 30075598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	34920657	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	BEFREE	8749923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	16792588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	7525343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	20191078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	21921589	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	28194801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	31983676	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	12580918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31572289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	22535415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23933413, 25793777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24474251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24474251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	37966470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	7665697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	16382212, 25897102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	BEFREE	31359380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28925763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	LHGDN	18707907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	BEFREE	30282881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	9888665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	26690142		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	26690142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28929125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30854694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	8598676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	23137758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia	Focal cortical dysplasia	BEFREE	14572449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	15027116		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	26690142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	18603066, 35351411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	31081048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	10736107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	28323210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	BEFREE	17051589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	Pubtator	27616475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	10643715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	10813290, 11299056, 11469468, 11911111, 27894415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	1712368	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	LHGDN	18197885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	37131205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16418217, 1974176, 22591734, 28964848, 29228586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	1974176, 22591734, 30959276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24252689	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	14615040, 16418217, 1974176, 22591734, 28964848, 29228586, 30959276, 31207928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	1370436, 19306055, 23178493, 24078801, 24289603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24289603, 26473373, 7506810, 7526247, 7537727, 7915264	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	10027408, 1381006, 1430258	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	1683616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	LHGDN	18574676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	30547763	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	35688937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	35172688, 9551397	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	18574676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	1381006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	35688937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	1370927, 21430507, 22796533, 27086024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	31300420	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	22796533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	27624647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	14688376, 1712368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	11936473, 14557478, 17873320, 23242661, 25617714, 28450957, 31359380		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	1378365, 25617714, 7902787	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	7626551	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	19419934, 39234250	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	24562464, 7680294, 9158103	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	22552879, 27595159, 31464097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	11936473, 23053969, 28388873, 28413469, 31359380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	1671565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	35871446	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	7626551	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	29695657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	31729904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	31275451, 35775773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31729904, 31778438		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Valve Diseases	Heart valve disease	Pubtator	28623907	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	22664113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	22664113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	1974471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	27021335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	32777069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	30481789	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	32635212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	30300903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	30300903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	34326842	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhagic Fever with Renal Syndrome	Hemorrhagic fever with renal syndrome	Pubtator	10461425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	11361181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	1347281, 33954832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	1360668	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	7706478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	7737571	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	1346374, 7657294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	11451166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	20193033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	36248794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	8749923, 9718651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	1605306, 9722296	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin Disease	BEFREE	16152613		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington disease	Pubtator	1605306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	CTD_human_DG	14602771		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia	Hypercholesterolemia	Pubtator	35282277	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	19004443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	15448102, 18365231, 18825362, 27981484, 28104396, 28351645, 28976221, 29307595, 30132524, 31330062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	20592773	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	16549444	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	19004443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity	Hypersensitivity	Pubtator	8102141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	1705751	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Delayed	Hypersensitivity	Pubtator	2571643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	24083591, 26004608, 26078712, 26391130	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	12149661, 12425201		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	15448102, 19078988, 24083591, 25310099, 26078712, 29936324, 31527830		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	25879517, 27858190, 37071849	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29743093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis linearis circumflexa	Netherton syndrome	BEFREE	11028565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27470556, 29687288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	11512562	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	1352747, 7904545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30526970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	29369345		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	19420105, 30547763, 31796125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	15756053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	15817637, 31491723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	12767492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	12374626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10563674, 10792421, 11726228, 12477764, 15123348, 15290909, 15334773, 15638228, 16497620, 16570073, 16741608, 18200516, 18647548, 25942347, 29757363, 31068803, 31443680, 7615193 View all (3 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	11923606, 12477764, 18647548, 23717571	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17610002, 34561227, 36361571	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	28067908		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory dermatosis	Dermatitis	BEFREE	15654951, 20065994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	31629408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	26200140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	27018499	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	26345838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	15634340, 7737636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	25500022	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	10562584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	12637697, 18791855, 26634518, 29399739, 30997752, 31157518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	32815572, 33458871, 35441431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	39394477	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	LHGDN	19141396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome 1	Kallmann Syndrome	BEFREE	15857930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	30713808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	7921411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	1430258, 38174742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	17560459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	22822941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	10231462, 33574979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	LHGDN	15593054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	22609477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lambert-Eaton Myasthenic Syndrome	Lambert-Eaton Myasthenic Syndrome	BEFREE	31236596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	38376278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leishmaniasis Cutaneous	Leishmaniasis	Pubtator	21905501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	9472661	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	9472661	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11195004, 21768400, 21816944, 31421859, 7935981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11877286, 1370201, 1671649, 28807569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15699173, 28216566	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	1352710	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	1974471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10706072, 11090069, 1708296, 1974471, 25795133, 26246143, 29720577, 9058727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	33422029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11090069, 11195004, 11264180, 1974471, 26246143, 9753054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	1356935, 28110427, 8920885, 9209305, 9219058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	27975098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukostasis	Leukostasis	CTD_human_DG	10485912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukostasis	Leukostasis	BEFREE	17653050, 27474370, 28274631, 28294475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	10938387, 24069166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	11278855	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10037274, 10551902, 1346374, 15205947, 23376424, 26341495, 26667486, 28894136, 30333872, 30349190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17974148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31662566		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver cirrhosis	Pubtator	35473775	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	14606706, 16038038, 7537707, 8104850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	25242329	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	7904546	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	33954832	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10037274, 1346374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	18446055, 9620222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	21816944, 30779919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	10607488	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	11512562, 19644880, 20360623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	29687288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	14509560, 15053044, 1680858, 22248682, 22266541, 26513172, 36688994, 7829125, 8880099, 9058094, 9620222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	22248682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	9039167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	7616001	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10598755, 1974276, 27847409, 7521807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11406523, 24083390, 28153882	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	35332100	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11406523, 22523428, 28153882, 29096830, 7653184, 9972961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	17340048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	11737595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	LHGDN	17340048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	29777158, 29953010, 30537116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	30537116	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24548863, 25450269, 26109813	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	28513273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	32356861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	1373268, 1384339, 21435201, 34503477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	7691638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	34879826, 7682455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	12011765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	1974471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	1974471, 38065859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	26473373, 7906727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	8774481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	24289603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14572152, 15774488, 17219382, 18256929, 18474291, 20459645, 21223991, 21590495, 23079714, 26299331, 26751847, 26872904, 27207667, 27876502, 28367091 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24474251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	1423266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	10037274, 17901709, 18028322, 20193033, 26341495, 28693245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17361014, 17786042, 21328467, 22198381, 22248682, 29148014, 29348824, 30573629, 8880099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	10938387, 24069166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	24069166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19389515, 25659662, 25879517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10374689, 17357279, 19904754, 29137327, 8093883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	16606632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16733712, 19219419, 22001597, 23559257, 23803661, 24742333, 26265203, 28042317, 31619256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	9192652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15522320, 22294843, 24548863, 25613482, 27557490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	25793777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21879273, 30119270, 31337787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21725879, 28355551, 31164632, 31273010, 9392053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10037274, 10374689, 10470114, 12651068, 15217903, 15334673, 16416166, 17108113, 17357279, 17786042, 19520829, 1974471, 22248682, 23824412, 23933413 View all (20 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15334673, 16497620, 16920698, 18084318, 25622900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	16497620, 7902311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	LHGDN	14993495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	31398886	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11914659, 12172576, 17337890, 18474291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15604251, 15774488, 28969074, 29986606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	22508288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	7992839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	7992839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	8599446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10382738, 10408388, 10414467, 1347555, 1370233, 15132836, 17649820, 21487066, 23284620, 26338962, 2643120, 28341549, 30116025, 35295096, 7627996 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10414467, 10644010, 10688373, 10702726, 11323217, 1281617, 1347555, 1355009, 1355429, 15132836, 16432463, 1671030, 1688067, 17575149, 20610626 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16152588, 16432463, 18199704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23039186, 25138157, 35538545, 8440919	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	15711569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	25178329	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28564681, 30035700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	31824303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	8774481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	10232421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	17112530, 18761738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	15448102, 17160670, 20494378, 28521868, 28634974, 30327716, 31092175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	16454657, 19047166, 28341549, 29245925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	19219419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	28549057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	36726727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	12374626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	25145994, 29237386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	26733571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	1372348, 36906717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	20647315, 24069166	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	24069166		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	28069066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	28069066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	22508288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10848782, 12135668, 12139739, 15287939, 17177159, 25341809, 28154173, 30736330, 32526706, 39503766, 8103718, 8797890, 8830734, 9649209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	11494147, 12135668, 18850009, 22996336, 24839982, 28702457, 30736330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	10792421, 11081805, 12590979, 12745437, 14551606, 17868277, 24435747, 28130760, 30412901, 30473535, 7507498, 9667594		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	12745437, 14551606, 17868277		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	12745437, 1972610, 24430173	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	CTD_human_DG	20175758		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis, Acute Fulminating	Multiple Sclerosis	CTD_human_DG	20175758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	25596452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	1281618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	20562331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	10606893	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	1974471, 20562331, 36503307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	1974471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21288887, 23180012, 25837664, 26722450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorder Chronic with Eosinophilia	Myeloproliferative disorder	Pubtator	8969030	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	26081516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	10070497		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	10475771	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	12127369, 17089918, 26662939, 27367417, 28881754, 30290609		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	15067196, 16820586, 18057581, 18604267, 20191078, 21533024, 23493781, 31739782, 9426029	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	10898423, 21808112	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	15379751, 26371161, 27816305, 8701848, 9670921		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	Pubtator	26945075, 35549587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	19353432, 19644880, 7507012, 9099932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	22763828	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	10931151, 18629784, 25573100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	LHGDN	18260262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	18352974, 19068102, 25573100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	39191825	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	1372880, 18087217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18087217, 34544905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	1360668	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	38065859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	28846670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10037274, 10048768, 10414467, 10551902, 10566143, 10738180, 10938387, 11122109, 11200836, 11358852, 11828261, 12222834, 12379327, 12651068, 12768192 View all (87 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	LHGDN	18656701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis	Nephrosis	CTD_human_DG	12845231		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nervous System Diseases	Nervous system disease	Pubtator	30214039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10438951, 1354203, 15554267, 9218873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	8494726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	25197660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	12095649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	12095649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	28549057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	34079083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	27975098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type B	Niemann-Pick Disease	BEFREE	28606376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	27998726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	30704307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16542141, 22562265, 31085700, 31488404, 7519825		★★★★★ ★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	19357230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	20217214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	11028565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	11782876		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	14975197, 15448102, 16807303, 17704300, 26498675, 27246625, 27853845, 28576439, 30848861		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	19249917, 21481180, 30572569	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obstructive azoospermia	Obstructive azoospermia	BEFREE	30704307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	14609532, 15934126, 24667577, 31146598, 31812161, 39379962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	15731292, 32384383	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	36216277	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	39379962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	35711689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31560285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	11028443	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	17390085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	LHGDN	17390085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	17390085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	LHGDN	17390085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	10849374, 9109391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24685520, 26503469, 27851822, 28903329, 31149396		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19389515, 25659662, 25879517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11720474, 25659662	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	14715418, 25659662, 25879517, 31312656, 35449452, 36854451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37644468	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	30196377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10374689, 11023195, 17357279, 8093883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	8093883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15053044, 21443201, 22335271, 32135474, 8093857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	19102398, 19129609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	15917409, 21443201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	15917409, 9888665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	21879273, 29025766, 30119270, 30414611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	9164632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	10225829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12524171, 24853996, 27844285, 29686831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	31581318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	27391418, 29193068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	11896824, 15618163, 18543247, 20825555, 23688098, 27391418, 29482504, 30341668, 31442933, 31823136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	15618163, 27391418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34213019	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	21245421		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	25287126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Peripheral vascular disease	Pubtator	25287126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	18350449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	18942221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	33203795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	CTD_human_DG	11181422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	21717173, 26498675, 27039809, 28521868, 31629408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	27039809, 31629408, 36793022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	29096830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	Pubtator	19644880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	23379997, 26828717, 28778657, 29157934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	21606482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	21172429, 26289958, 30054439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	16038038, 7904546, 9089909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	31236596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	15123348, 16750586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	18942221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16733712, 19219419, 23559257, 23803661, 24742333, 26265203, 28042317, 31619256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	16606632		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16733712		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	23559257, 24742333, 28042317		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23559257, 23803661, 24151226, 26265203, 26537072, 30577600, 33569050	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prune Belly Syndrome	Prune belly syndrome	BEFREE	30196377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudoxanthoma Elasticum	Pseudoxanthoma elasticum	BEFREE	18440309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudoxanthoma Elasticum	Pseudoxanthoma elasticum	LHGDN	18440309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	15186319, 28940220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	11310827		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	8721479	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	18029384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	20808962, 24083390	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29687288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	14624669, 16611655, 16907910, 20395558, 23635004, 33260035, 40161396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28056984	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	15011745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	7905208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Raynaud Disease	Raynaud disease	Pubtator	38302542	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	1423266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19360351, 25973014, 7521786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	17167153, 28237649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal hypertension	Renal Hypertension	BEFREE	28778706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	27246625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28473322, 30587921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	12027924, 16759306, 19482023, 29522144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	CTD_human_DG	19324842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	25675437, 27380422, 29743093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	9222276		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	21262518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	23913188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10090156, 10447928, 11072593, 11908555, 12296865, 12632416, 15361125, 15756053, 17009243, 19597294, 20432452, 20604932, 23632129, 27894415, 29660333 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12175089, 17963163, 18392953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	7613226, 7819742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	23472126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	11817671	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	19077082, 26368286, 7904545, 9797497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis Pulmonary	Sarcoidosis	Pubtator	11817671, 7904545, 7905208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	24584817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	18212050, 33104883, 34831294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	17047149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15756053, 28942562, 30214039		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	15756053		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15756053		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	15756053, 30214039, 36182530	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	16447227, 1979737, 9595538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	18029384, 23685129	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	24083390, 30157947	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	12498973, 15048650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	16288410, 29028771, 29345380, 29432911, 29565737, 30542424, 31028466, 31192950, 31281454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	8509947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	10403921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick Sinus Syndrome	BEFREE	29068581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	11359451, 36768371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	12808331, 2469738, 7539468, 7706764, 7738361, 7798616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	30842373	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	19906207, 20065994, 24645721, 30025384, 30183461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	7798616, 9192652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Ulcer	Skin ulcer	Pubtator	10086854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	27693879	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	30653588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	LHGDN	15387368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	8880099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	8880099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Splenic Hypoplasia	Splenic Hypoplasia	BEFREE	25441669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	9029017	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SPONDYLOCARPOTARSAL SYNOSTOSIS SYNDROME	Spondylocarpotarsal Synostosis Syndrome	BEFREE	20386338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10198224, 24069166, 8098727, 9039974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25428380, 30128011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24069166, 24205072, 24398980, 32121422, 35211756, 37082943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25450269	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	9328140	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	29893361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28929125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12373302, 15522320, 16416166, 17708604, 22294843, 24548863, 25613482, 27557490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	35473775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10722567, 16773720, 17708604, 22294843, 22408359, 24548863, 25441488, 29917191, 32373959, 9529982, 9683305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16773720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	18604267, 20191078, 21533024	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	39394477	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28030939, 28682429, 29162556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	8509947		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	8509947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	10090156, 15934126, 1701992, 30887556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	11014344, 15934126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	12115192, 1371389, 1457282, 16447227, 1718289, 1979737, 21068089, 29687288, 9595538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetany	Tetany	Pubtator	27889981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia 1	Thrombocytopenia	Pubtator	20130240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	17677000, 25988387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	26109813	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	10886240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	14557478, 17873320, 20107176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	15331401, 30414611, 35871446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21879273, 30119270, 31337787, 9492149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	11936473, 12774035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	21879273, 29025766, 30119270, 31337787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	36906717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	LHGDN	11936473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	7902787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichothiodystrophy Syndromes	Trichothiodystrophy	BEFREE	9192652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichothiodystrophy Syndromes	Trichothiodystrophy	Pubtator	9192652	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29505261, 29684714, 30082828, 30623283, 30906868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30082828, 37671167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36373309, 36444196	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	14572449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	LHGDN	14572449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11726228, 15290909, 16497620, 16741608, 19083096, 24345805, 25942347, 28928792, 29207381, 7615193		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	LHGDN	15550998, 16158332		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	15553846		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uremia	Uremia	CTD_human_DG	17347482		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	12357319, 1353063, 15053044, 16780590, 19913990, 24857933, 28355551, 29966014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	CTD_human_DG	12121561		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Dysplasia	Uterine disease	Pubtator	10209502, 8102029	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	30956760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	20445114, 23401649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	Pubtator	20445114, 23401649, 9640196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis Posterior	Uveitis	Pubtator	27293321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis, Posterior	Uveitis	BEFREE	27293321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	20632821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	10722838, 12142120, 23401649, 25323856, 25489974, 26761204, 27884380, 30572569, 30871567, 31782253, 35245485, 38195507, 39182041, 40187599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	11250042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	32382091, 33954832, 9152314	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	12714608, 24566270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	10027408, 11406523, 12808331, 9158091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	11361181, 11406523, 27894415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis Central Nervous System	Vasculitis	Pubtator	9158091	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis Leukocytoclastic Cutaneous	Vasculitis	Pubtator	7561155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis of the skin	Vasculitis	BEFREE	23457623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous insufficiency	Pubtator	10086854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	24339944	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	35711689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	11121127, 23777204, 24312346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	21877251, 22333690, 24312346, 28273427		★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	21877251, 22333690, 24312346, 28273427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	9187938		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked Adrenal Hypoplasia	Adrenal Hypoplasia, X-Linked	BEFREE	29284752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xanthomatosis	Xanthomatosis	Pubtator	24428816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum Complementation Group D	Xeroderma pigmentosum	Pubtator	9192652	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	9192652		★★★★★ ★☆☆☆☆ Found in Text Mining only

ICAM1 (intercellular adhesion molecule 1)