HTN3 (histatin 3) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	3347
Gene name	Histatin 3
Gene symbol	HTN3
Synonyms (NCBI Gene)	HIS2HTN2HTN5Hst 3PB
Chromosome	4
Chromosome location	4q13.3
Summary	This gene encodes a member of the histatin family of small, histidine-rich, cationic proteins. They function as antimicrobial peptides and are important components of the innate immune system. Histatins are found in saliva and exhibit antibacterial, antif

2

SNP ID	Visualize variation	Clinical significance	Consequence
rs1136511	G>A	Pathogenic	Coding sequence variant, missense variant
rs17147990	T>A	Pathogenic	Coding sequence variant, stop gained

5

miRTarBase ID	miRNA	Experiments	Reference
MIRT018323	hsa-miR-335-5p	Microarray	18185580
MIRT2245354	hsa-miR-3613-3p	CLIP-seq
MIRT2245355	hsa-miR-4519	CLIP-seq
MIRT2451463	hsa-miR-425	CLIP-seq
MIRT2451464	hsa-miR-580	CLIP-seq

25 Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	23499434, 26775844, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	3286634, 8336540
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	3286634, 12711380
GO:0005739	Component	Mitochondrion	IDA	32225006
GO:0005739	Component	Mitochondrion	IEA
GO:0031214	Process	Biomineral tissue development	IEA
GO:0031640	Process	Killing of cells of another organism	IDA	3286634, 11083804, 11717389, 12711380, 15485849, 22033918, 23613860, 28261570, 32751915
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0031640	Process	Killing of cells of another organism	IMP	28763199
GO:0042742	Process	Defense response to bacterium	IDA	28261570
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042742	Process	Defense response to bacterium	NAS	3286634, 8336540
GO:0042803	Function	Protein homodimerization activity	IDA	32751915
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IMP	26775844
GO:0050832	Process	Defense response to fungus	IDA	11083804, 11717389, 15485849, 22033918, 23613860, 26379655, 32751915
GO:0050832	Process	Defense response to fungus	IEA
GO:0050832	Process	Defense response to fungus	IMP	28763199
GO:0060090	Function	Molecular adaptor activity	IMP	26775844
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	3286634, 12711380
GO:0090303	Process	Positive regulation of wound healing	IDA	18650243

MIM	HGNC	e!Ensembl
142702	5284	ENSG00000205649

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	P15516
Protein name	Histatin-3 (Basic histidine-rich protein) (Hst) (Histatin 3) (Hst 3) (Histidine-rich protein 3) (PB) [Cleaved into: Histatin-3; His3-(20-44)-peptide (His3 20/44) (His3-(1-25)-peptide) (His3 1/25) (Histatin 6) (Histatin-3 1/25) (Histatin-6); His3-(20-43)-p
Protein function	Histatins are cationic and histidine-rich peptides mainly found in the saliva of higher primates (PubMed:3286634). They are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). Hsts can
Family and domains
Sequence	MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
Sequence length	51
Interactions	View interactions

KEGG Pathway	Reactome Pathway
Salivary secretion	Antimicrobial peptides