HSPB2 (heat shock protein family B (small) member 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3316
• Gene name: Heat shock protein family B (small) member 2
• Gene symbol: HSPB2
• Synonyms (NCBI Gene): HSP27, Hs.78846, LOH11CR1K, MKBP
• Chromosome: 11
• Chromosome location: 11q23.1
• Summary: The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The protein is expressed preferentially in the heart and skeletal muscle. Th

miRNA Show/Hide all (9)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031369	hsa-miR-17-5p	Western blot	20209605
MIRT031369	hsa-miR-17-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35154459
MIRT2012962	hsa-miR-193a-5p	CLIP-seq
MIRT2012963	hsa-miR-3688-5p	CLIP-seq
MIRT2012964	hsa-miR-4731-5p	CLIP-seq
MIRT2245215	hsa-miR-4446-5p	CLIP-seq
MIRT2245216	hsa-miR-4755-5p	CLIP-seq
MIRT2245217	hsa-miR-501-3p	CLIP-seq
MIRT2245218	hsa-miR-502-3p	CLIP-seq

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005212	Function	Structural constituent of eye lens	IEA
GO:0005515	Function	Protein binding	IPI	14594798, 23188086, 25556234, 26465331, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19464326
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19464326
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS	9490724
GO:0006986	Process	Response to unfolded protein	NAS	9344664
GO:0007525	Process	Somatic muscle development	IEA
GO:0008047	Function	Enzyme activator activity	TAS	9490724
GO:0009408	Process	Response to heat	IBA
GO:0042026	Process	Protein refolding	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0051082	Function	Unfolded protein binding	IBA

Other IDs

• MIM: 602179
• HGNC: 5247
• e!Ensembl: ENSG00000170276

Protein

• UniProt ID: Q16082
• Protein name: Heat shock protein beta-2 (HspB2) (DMPK-binding protein) (MKBP) (Heat shock protein family B member 2)
• Protein function: May regulate the kinase DMPK.
• PDB: 6F2R
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00011	HSP20	66 → 163	Hsp20/alpha crystallin family	Family
  PF00525	Crystallin	10 → 54	Alpha crystallin A chain, N terminal	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed preferentially in skeletal muscle and heart but not in the lens.
• Sequence:

  MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGS
  RAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRT
  YVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIV
  EP

• Sequence length: 182

Pathways

KEGG Pathway:

Proteoglycans in cancer

Related Genes

No strongly related genes found yet for HSPB2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to HSPB2.