Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	3311
Gene name	Heat shock protein family A (Hsp70) member 7 (pseudogene)
Gene symbol	HSPA7
Synonyms (NCBI Gene)	HSP70B
Chromosome	1
Chromosome location	1q23.3

15 Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0006457	Process	Protein folding	IBA
GO:0008180	Component	COP9 signalosome	IDA	18850735
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0031072	Function	Heat shock protein binding	IBA
GO:0042026	Process	Protein refolding	IBA
GO:0044183	Function	Protein folding chaperone	IBA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA

MIM	HGNC	e!Ensembl
140556	5240	ENSG00000225217

P48741

Protein name

Putative heat shock 70 kDa protein 7 (Heat shock 70 kDa protein B) (Heat shock protein family A member 7)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00012	HSP70	8 → 363	Hsp70 protein	Family

Sequence

MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQ
AALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFQVVSEGGKPKVRVCYRGEDKTFYPEE
ISSMVLSKMKETAEAYLGQPVKHAVITVPTYFSNSQRQATKDAGAIAGLKVLPIINEATA
AAIAYGLDRRGAGKRNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLV
NHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTPSSSTQATLEIDSLFEGVDFYKSIT
RARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDFVLGGGLHSHPQGAEVAAGLLQRQG
AEQEHQP

Sequence length

367

Interactions

View interactions

Related Genes Genes most often co-reported with HSPA7 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for HSPA7.

Diseases Linked via Similar Genes Diseases curated for genes most similar to HSPA7 (see Related Genes above), that are NOT already directly curated for HSPA7 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to HSPA7.

HSPA7 (heat shock protein family A (Hsp70) member 7 (pseudogene))

Save This Analysis