HSP90AB3P (heat shock protein 90 alpha family class B member 3, pseudogene)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3327
• Gene name: Heat shock protein 90 alpha family class B member 3, pseudogene
• Gene symbol: HSP90AB3P
• Synonyms (NCBI Gene): HSP90BC, HSPCP1
• Chromosome: 4
• Chromosome location: 4q22.1

Gene ontology (GO) Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005524	Function	ATP binding	IBA
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IEA
GO:0007004	Process	Telomere maintenance via telomerase	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0031396	Process	Regulation of protein ubiquitination	IEA
GO:0032991	Component	Protein-containing complex	IBA
GO:0034605	Process	Cellular response to heat	IBA
GO:0034774	Component	Secretory granule lumen	IEA
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0050821	Process	Protein stabilization	IBA
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051131	Process	Chaperone-mediated protein complex assembly	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070182	Function	DNA polymerase binding	IEA
GO:0097718	Function	Disordered domain specific binding	IEA
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA
GO:1904813	Component	Ficolin-1-rich granule lumen	IEA
GO:1905323	Process	Telomerase holoenzyme complex assembly	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q58FF7
• Protein name: Putative heat shock protein HSP 90-beta-3 (Heat shock protein 90-beta c) (Heat shock protein 90Bc)
• Protein function: Putative molecular chaperone that may promote the maturation, structural maintenance and proper regulation of specific target proteins.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00183	HSP90	343 → 582	Hsp90 protein	Family
  PF00183	HSP90	170 → 345	Hsp90 protein	Family
  PF02518	HATPase_c	35 → 168	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase	Domain

• Sequence:

  MPEEVHHGEEEVETFAFQAEIAQLISLIINTFYSNEEIFLQELISNASDALDKIRYESLT
  DPSKLDSGKELKIDIIPNPQERTLALVDTGIGMTKADLINNLRTIAKSGTKACMEALQAE
  KLVVITKHNDDEQYAWESSAGGSFTVHADHGEPIGRGTKVILHLKEDQTEYLEERRVKEV
  VKKHSQFIGYPITLYLEKEQDKEISDDEAEEEKGEKEEEDKDDEEKPKIKDVGSDEEDDS
  KEYGEFYKSLTSDWEDHLAVKHFSVEGQLEFRALLFSPRRAPFDLFENKKKKNNIKLYVR
  RVFIMDSCDELIPEYLNFIHGVVDSEDLPLNISREMLQQSKILKYVSHMKETQKSTYYIT
  GESKEQVANSAFVERVRKQGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDE
  EEKKKMEESKEKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMEQIMK
  AQALRDNSTMGYMMAKKHLEINPDHPIMETLRQKAEADKNDKAVKDLVVLLFETALLSSG
  FSLEDPQTHSNHIYHMIKLGLGTDEDEVAAEEPSDAVPDEIPPLEGDEDASRMEEVD

• Sequence length: 597

Related Genes

No strongly related genes found yet for HSP90AB3P.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to HSP90AB3P.