HSP90AA4P (heat shock protein 90 alpha family class A member 4, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 3323
Gene name Heat shock protein 90 alpha family class A member 4, pseudogene
Gene symbol HSP90AA4P
Synonyms (NCBI Gene)
HSP90AdHSPCAL2
Chromosome 4
Chromosome location 4q35.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0005515 Function Protein binding IPI 28514442, 33961781
GO:0005524 Function ATP binding IEA
GO:0005737 Component Cytoplasm IEA
GO:0006457 Process Protein folding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 5255 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q58FG1
Protein name Putative heat shock protein HSP 90-alpha A4 (Heat shock 90 kDa protein 1 alpha-like 2) (Heat shock protein 90-alpha D) (Heat shock protein 90Ad)
Protein function Putative molecular chaperone that may promote the maturation, structural maintenance and proper regulation of specific target proteins.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00183 HSP90 205 → 411 Hsp90 protein Family
PF00183 HSP90 80 → 209 Hsp90 protein Family
PF13589 HATPase_c_3 12 → 134 Domain
Sequence 
MESLTDPSKLDSGKEPHISLIPNKQDRTLTIVDTGIGMTKADLINNLGTITKSETKVFME
VLQAGADISMIGQFSVGFYSAYSVAEKVTVITKHNNDEQYAWESSLRGSFTEYREFYKSL
TINWEDYLAVKHFSVEGQLEFRAFLFVPRLAPFELLETRKKKNKIKLSARRDLIMDNCEE
LIPEYLNFIRGVVDSEDLPLNIFRETKDQVANSTIVQRLWKHGLEVIYTIEPIDEYCVQQ
LKEFEGKTLVSVTKEDLELPEDEEEKKKQEEGKQKTKQKKNQSLRTSAKSTYGWTANMER
IMKAQALRDNSTTGYMAAKKHLEINPDHSFIDTLRQKAETDKNDKSVKDLVILLYETALL
SSDFGLEGPQTHANRIYRMNKLGLGTDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEK
Sequence length 418
Interactions View interactions

No strongly related genes found yet for HSP90AA4P.

No additional diseases found yet through genes similar to HSP90AA4P.