HSFX3 (heat shock transcription factor family, X-linked member 3)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 101928917
Gene name Heat shock transcription factor family, X-linked member 3
Gene symbol HSFX3
Synonyms (NCBI Gene)
-
Chromosome X
Chromosome location Xq28
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity IEA
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
301151 52395 ENSG00000283697
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A1B0GWH4
Protein name Heat shock transcription factor, X-linked member 3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00447 HSF_DNA-bind 83 → 182 HSF-type DNA-binding Domain
Sequence 
MASQNTEQEYEAKLAPSVGGEPTSGGPSGSSPDPNPDSSEVLDRHEDQAMSQDPGSQDNS
PPEDRNQRVVNVEDNHNLFRLSFPRKLWTIVEEDTFKSVSWNDDGDAVIIDKDLFQREVL
QRKGAERIFKTDSLTSFIRQLNLYGFCKTRPSNSPGNKKMMIYCNSNFQRDKPRLLENIQ
RKDALRNTAQQATRVPTPKRKNLVATRRSLRIYHINARKEAIKMCQQGAPSVQGPSGTQS
FRRSGMWSKKSATRHPLGNGPPQEPNGPSWEGTSGNVTFTSSATTWMEGTGILSSLVYSD
NGSVMSLYNICYYALLASLSVMSPNEPSDDEEE
Sequence length 333
Interactions View interactions

No strongly related genes found yet for HSFX3.

No additional diseases found yet through genes similar to HSFX3.