HRES1 (HTLV-1 related endogenous sequence (pseudogene))

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 3272
Gene name HTLV-1 related endogenous sequence (pseudogene)
Gene symbol HRES1
Synonyms (NCBI Gene)
HRES-1HRES-1/p28
Chromosome 1
Chromosome location 1q42
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0005575 Component Cellular_component ND
GO:0008150 Process Biological_process ND
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
143025 5180 HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P13985
Protein name Putative HTLV-1-related endogenous sequence (p25)
Family and domains
Sequence 
MRCAHAPAPRTRYPTRAPSGPRPPSRSQAQTPPRSVPRLRPRHRHPQDPRSPGPAPRHRR
PPRPDPRAPPARASYRRFRTWPSATSWERRRLSPGHRALARGPPARLGGEGPGAGDRRRE
GPDRSPRQPPVLPAAAAQPDSSSAQAPGPSTLRPAATARRKRRWATRGPAHPAFARAHGE
AGAGRVRTSARAGSTCAGWALWRCALRWAERQVGALGAESRFP
Sequence length 223
Interactions View interactions

No strongly related genes found yet for HRES1.

No additional diseases found yet through genes similar to HRES1.