Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	3234
Gene name	Homeobox D8
Gene symbol	HOXD8
Synonyms (NCBI Gene)	HOX4HOX4EHOX5.4
Chromosome	2
Chromosome location	2q31.1
Summary	This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster

95 Show/Hide all (95)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002941	hsa-miR-196a-5p	Western blot	19418581
MIRT002941	hsa-miR-196a-5p	Review	20029422
MIRT004639	hsa-miR-196b-5p	Review	20029422
MIRT002941	hsa-miR-196a-5p	Luciferase reporter assay	15105502
MIRT086304	hsa-miR-4476	PAR-CLIP	20371350
MIRT086307	hsa-miR-6876-5p	PAR-CLIP	20371350
MIRT506951	hsa-miR-1827	PAR-CLIP	20371350
MIRT506950	hsa-miR-6765-5p	PAR-CLIP	20371350
MIRT506949	hsa-miR-653-5p	PAR-CLIP	20371350
MIRT086301	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT086304	hsa-miR-4476	PAR-CLIP	21572407
MIRT086307	hsa-miR-6876-5p	PAR-CLIP	21572407
MIRT506951	hsa-miR-1827	PAR-CLIP	21572407
MIRT506950	hsa-miR-6765-5p	PAR-CLIP	21572407
MIRT506949	hsa-miR-653-5p	PAR-CLIP	21572407
MIRT086301	hsa-miR-1304-5p	PAR-CLIP	21572407
MIRT086304	hsa-miR-4476	PAR-CLIP	23446348
MIRT086307	hsa-miR-6876-5p	PAR-CLIP	23446348
MIRT506951	hsa-miR-1827	PAR-CLIP	23446348
MIRT506950	hsa-miR-6765-5p	PAR-CLIP	23446348
MIRT506949	hsa-miR-653-5p	PAR-CLIP	23446348
MIRT086301	hsa-miR-1304-5p	PAR-CLIP	23446348
MIRT086295	hsa-miR-520a-3p	ImmunofluorescenceqRT-PCRWestern blot	27748920
MIRT086304	hsa-miR-4476	PAR-CLIP	20371350
MIRT086307	hsa-miR-6876-5p	PAR-CLIP	20371350
MIRT506951	hsa-miR-1827	PAR-CLIP	20371350
MIRT506950	hsa-miR-6765-5p	PAR-CLIP	20371350
MIRT506949	hsa-miR-653-5p	PAR-CLIP	20371350
MIRT086301	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT086304	hsa-miR-4476	PAR-CLIP	21572407
MIRT086307	hsa-miR-6876-5p	PAR-CLIP	21572407
MIRT506951	hsa-miR-1827	PAR-CLIP	21572407
MIRT506950	hsa-miR-6765-5p	PAR-CLIP	21572407
MIRT506949	hsa-miR-653-5p	PAR-CLIP	21572407
MIRT086301	hsa-miR-1304-5p	PAR-CLIP	21572407
MIRT086304	hsa-miR-4476	PAR-CLIP	23446348
MIRT086307	hsa-miR-6876-5p	PAR-CLIP	23446348
MIRT506951	hsa-miR-1827	PAR-CLIP	23446348
MIRT506950	hsa-miR-6765-5p	PAR-CLIP	23446348
MIRT506949	hsa-miR-653-5p	PAR-CLIP	23446348
MIRT086301	hsa-miR-1304-5p	PAR-CLIP	23446348
MIRT1053797	hsa-miR-1297	CLIP-seq
MIRT1053798	hsa-miR-191	CLIP-seq
MIRT1053799	hsa-miR-193a-3p	CLIP-seq
MIRT1053800	hsa-miR-193b	CLIP-seq
MIRT1053801	hsa-miR-26a	CLIP-seq
MIRT1053802	hsa-miR-26b	CLIP-seq
MIRT1053803	hsa-miR-3136-3p	CLIP-seq
MIRT1053804	hsa-miR-3647-3p	CLIP-seq
MIRT1053805	hsa-miR-3662	CLIP-seq
MIRT1053806	hsa-miR-4325	CLIP-seq
MIRT1053807	hsa-miR-4465	CLIP-seq
MIRT1053808	hsa-miR-4724-5p	CLIP-seq
MIRT1053809	hsa-miR-519a	CLIP-seq
MIRT1053810	hsa-miR-519b-3p	CLIP-seq
MIRT1053811	hsa-miR-519c-3p	CLIP-seq
MIRT2012205	hsa-miR-1238	CLIP-seq
MIRT2012206	hsa-miR-1266	CLIP-seq
MIRT1053797	hsa-miR-1297	CLIP-seq
MIRT1053801	hsa-miR-26a	CLIP-seq
MIRT1053802	hsa-miR-26b	CLIP-seq
MIRT2012207	hsa-miR-3127-5p	CLIP-seq
MIRT2012208	hsa-miR-3158-3p	CLIP-seq
MIRT2012209	hsa-miR-3183	CLIP-seq
MIRT1053805	hsa-miR-3662	CLIP-seq
MIRT2012210	hsa-miR-3664-3p	CLIP-seq
MIRT2012211	hsa-miR-3918	CLIP-seq
MIRT1053806	hsa-miR-4325	CLIP-seq
MIRT1053807	hsa-miR-4465	CLIP-seq
MIRT2012212	hsa-miR-4518	CLIP-seq
MIRT2012213	hsa-miR-4723-3p	CLIP-seq
MIRT1053809	hsa-miR-519a	CLIP-seq
MIRT1053810	hsa-miR-519b-3p	CLIP-seq
MIRT1053811	hsa-miR-519c-3p	CLIP-seq
MIRT1053798	hsa-miR-191	CLIP-seq
MIRT2244591	hsa-miR-3065-5p	CLIP-seq
MIRT2244592	hsa-miR-30a	CLIP-seq
MIRT2244593	hsa-miR-30b	CLIP-seq
MIRT2244594	hsa-miR-30c	CLIP-seq
MIRT2244595	hsa-miR-30d	CLIP-seq
MIRT2244596	hsa-miR-30e	CLIP-seq
MIRT1053804	hsa-miR-3647-3p	CLIP-seq
MIRT2244597	hsa-miR-3974	CLIP-seq
MIRT2244598	hsa-miR-4266	CLIP-seq
MIRT2244599	hsa-miR-4691-3p	CLIP-seq
MIRT1053808	hsa-miR-4724-5p	CLIP-seq
MIRT2244600	hsa-miR-651	CLIP-seq
MIRT2547481	hsa-miR-186	CLIP-seq
MIRT1053798	hsa-miR-191	CLIP-seq
MIRT2547482	hsa-miR-3133	CLIP-seq
MIRT1053804	hsa-miR-3647-3p	CLIP-seq
MIRT2547483	hsa-miR-3937	CLIP-seq
MIRT2547484	hsa-miR-4511	CLIP-seq
MIRT2244599	hsa-miR-4691-3p	CLIP-seq
MIRT1053808	hsa-miR-4724-5p	CLIP-seq

21 Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	1756725
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	1756725
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	2568311
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008595	Process	Anterior/posterior axis specification, embryo	NAS	2568311
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	1756725
GO:0048705	Process	Skeletal system morphogenesis	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
142985	5139	ENSG00000175879

P13378

Protein name

Homeobox protein Hox-D8 (Homeobox protein Hox-4E) (Homeobox protein Hox-5.4)

Protein function

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	198 → 254	Homeodomain	Domain

Sequence

MSSYFVNPLYSKYKAAAAAAAAAGEAINPTYYDCHFAPEVGGRHAAAAAALQLYGNSAAG
FPHAPPQAHAHPHPSPPPSGTGCGGREGRGQEYFHPGGGSPAAAYQAAPPPPPHPPPPPP
PPPCGGIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSS
SPSQMFPWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQ
VKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQELEEDRAEGLTN

Sequence length

290

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HOXD8-related disorder	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (28)
Benign Neoplasm	Benign Neoplasm	BEFREE	30194340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	35177798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38130932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30941968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28457970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	30194340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30194340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20127028, 28457970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28457970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	7813807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30194340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28457970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30626726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Pilocytic Astrocytoma	Astrocytoma	BEFREE	25085602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30941968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28457970, 32373967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27748920, 30194340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31980996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28457970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22879880, 28457970, 7501971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22879880, 7501971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27748920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	30194340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30194340, 36213580	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34944472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24076275, 24519855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	24519855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndactyly, type 2	Syndactyly	BEFREE	7581388		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with HOXD8 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for HOXD8.

Diseases Linked via Similar Genes Diseases curated for genes most similar to HOXD8 (see Related Genes above), that are NOT already directly curated for HOXD8 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to HOXD8.

HOXD8 (homeobox D8)

Save This Analysis