Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	3233
Gene name	Homeobox D4
Gene symbol	HOXD4
Synonyms (NCBI Gene)	HHO.C13HOX-5.1HOX4HOX4BHox-4.2
Chromosome	2
Chromosome location	2q31.1
Summary	This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster

27 Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT623680	hsa-miR-6835-3p	HITS-CLIP	23824327
MIRT623679	hsa-miR-451b	HITS-CLIP	23824327
MIRT648193	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT623678	hsa-miR-302a-5p	HITS-CLIP	23824327
MIRT623677	hsa-miR-4326	HITS-CLIP	23824327
MIRT623676	hsa-miR-9-3p	HITS-CLIP	23824327
MIRT623675	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT623680	hsa-miR-6835-3p	HITS-CLIP	23824327
MIRT623679	hsa-miR-451b	HITS-CLIP	23824327
MIRT623678	hsa-miR-302a-5p	HITS-CLIP	23824327
MIRT623677	hsa-miR-4326	HITS-CLIP	23824327
MIRT623676	hsa-miR-9-3p	HITS-CLIP	23824327
MIRT623675	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT623680	hsa-miR-6835-3p	HITS-CLIP	23824327
MIRT623679	hsa-miR-451b	HITS-CLIP	23824327
MIRT648193	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT623678	hsa-miR-302a-5p	HITS-CLIP	23824327
MIRT623677	hsa-miR-4326	HITS-CLIP	23824327
MIRT623676	hsa-miR-9-3p	HITS-CLIP	23824327
MIRT623675	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT623680	hsa-miR-6835-3p	HITS-CLIP	23824327
MIRT623679	hsa-miR-451b	HITS-CLIP	23824327
MIRT623678	hsa-miR-302a-5p	HITS-CLIP	23824327
MIRT623677	hsa-miR-4326	HITS-CLIP	23824327
MIRT623676	hsa-miR-9-3p	HITS-CLIP	23824327
MIRT623675	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT1053796	hsa-miR-542-3p	CLIP-seq

26 Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IMP	1756725
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	1756725
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	1756725
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0030054	Component	Cell junction	IDA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	1756725
GO:0048568	Process	Embryonic organ development	IEP	2879245
GO:0048704	Process	Embryonic skeletal system morphogenesis	IBA
GO:0048704	Process	Embryonic skeletal system morphogenesis	IEA
GO:0048863	Process	Stem cell differentiation	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
142981	5138	ENSG00000170166

P09016

Protein name

Homeobox protein Hox-D4 (Homeobox protein HHO.C13) (Homeobox protein Hox-4B) (Homeobox protein Hox-5.1)

Protein function

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	155 → 211	Homeodomain	Domain

Sequence

MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQ
PFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQ
PPSGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLT
RRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQH
LQPMAKDHHTDLTTL

Sequence length

255

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Leukemia, acute lymphoblastic, susceptibility to	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (22)
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	15776434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15776434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arachnoid Cysts	Arachnoid cysts	Pubtator	26545093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arachnoid Cysts	Arachnoid cyst	BEFREE	26545093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19232136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22976466	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37827698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	15776434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	15776434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	30588951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29383189		★★★★★ ★☆☆☆☆ Found in Text Mining only
L2 Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	CTD_human_DG	15776434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30588951	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15776434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30588951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	7501971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36213580	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	15776434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	7501971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	7501971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21562367, 30588951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	37827698	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with HOXD4 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for HOXD4.

Diseases Linked via Similar Genes Diseases curated for genes most similar to HOXD4 (see Related Genes above), that are NOT already directly curated for HOXD4 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to HOXD4.

HOXD4 (homeobox D4)

Save This Analysis