Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	399949
Gene name	HOATZ cilia and flagella associated protein
Gene symbol	HOATZ
Synonyms (NCBI Gene)	C11orf88
Chromosome	11
Chromosome location	11q23.1

13 Show/Hide all (13)

GO ID	Ontology	Definition	Evidence
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005929	Component	Cilium	IEA
GO:0005929	Component	Cilium	ISS
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030317	Process	Flagellated sperm motility	ISS
GO:0035082	Process	Axoneme assembly	IEA
GO:0035082	Process	Axoneme assembly	ISS
GO:0042995	Component	Cell projection	IEA
GO:0060271	Process	Cilium assembly	IEA
GO:0060271	Process	Cilium assembly	ISS

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6PI97

Protein name

Cilia- and flagella-associated protein HOATZ

Protein function

Required for motile ciliogenesis and flagellar genesis by mediating the maturation of the glycolytic enzyme ENO4.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17664	DUF5526	1 → 169	Family of unknown function (DUF5526)	Family

Sequence

METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPSESQLVLRRDS
SQRLPVARPRRSRGSENSHSSQSFHLASNKNRDIFAEALKIQESEEKVKYLQKAKTREEI
LQLLRKQREERISKELISLPYKPKAKEHKAKKVVSESDKEDQEEVKTLD

Sequence length

169

Interactions

View interactions

Related Genes Genes most often co-reported with HOATZ across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for HOATZ.

Diseases Linked via Similar Genes Diseases curated for genes most similar to HOATZ (see Related Genes above), that are NOT already directly curated for HOATZ itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to HOATZ.

HOATZ (HOATZ cilia and flagella associated protein)

Bookmark This Gene