HNRNPCL2 (heterogeneous nuclear ribonucleoprotein C like 2)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 440563
Gene name Heterogeneous nuclear ribonucleoprotein C like 2
Gene symbol HNRNPCL2
Synonyms (NCBI Gene)
HNRNPCP5
Chromosome 1
Chromosome location 1p36.21
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IBA
GO:0003723 Function RNA binding IEA
GO:0005515 Function Protein binding IPI 30021884, 32296183, 33961781
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
B2RXH8
Protein name Heterogeneous nuclear ribonucleoprotein C-like 2 (hnRNP C-like-2)
Protein function May play a role in nucleosome assembly by neutralizing basic proteins such as A and B core hnRNPs.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 18 → 80 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Sequence 
MASNVTNKMDPHSVNSRVFIGNLNTLVVKKSDVEAIFSKYGKIAGCSVHKGFAFVQYDKE
KNARAAVAGEDGRMIASQVAVINLAAEPKVNRGNAGVKRSAAEMYGSSFDLDYGFQRDYY
DGMYSFPARVPPPPPIALAVVPSKRQRISGNTSRRGKSGFNSKSGKRGSSKSGKLKGDDL
QAIKQELTQIKQKVDSLLENLEKIEKEQSKQEVEVKNAKSEEEQSSSSMKKDETHVKMES
EGGAEDSAEEGDPLDDDDNEDQGDNQLHLIKNNEKDAEEGEDNRDSTNGQDDS
Sequence length 293
Interactions View interactions

No strongly related genes found yet for HNRNPCL2.

No additional diseases found yet through genes similar to HNRNPCL2.