HMGN2P46 (high mobility group nucleosomal binding domain 2 pseudogene 46)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 283651
Gene name High mobility group nucleosomal binding domain 2 pseudogene 46
Gene symbol HMGN2P46
Synonyms (NCBI Gene)
C15orf21D-PCa-2
Chromosome 15
Chromosome location 15q21.1
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
611314 26817 HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86SG4
Protein name Putative Dresden prostate carcinoma protein 2 (D-PCa-2) (High mobility group nucleosome-binding domain-containing protein 2 pseudogene 46)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Very high expression in prostate and prostate cancer. Faint expression in other tissues. {ECO:0000269|PubMed:15027122}.
Sequence 
MEPWAMRALDFADESGSVSCKDMHLLLWLQKRIEMHKAEQCEEEEAMTPRPTKARAPLPS
AYVPPLSLPPCPRERLKGMLKEIKPRLSRNCREDPQGCLLNLLLQSHSRSPERPLQRRER
RYLQRRREKLMLARRGITLQKMEMPKQTRHRKLKVLEMPSEVCAFLITVYFW
Sequence length 172
Interactions View interactions

No strongly related genes found yet for HMGN2P46.

No additional diseases found yet through genes similar to HMGN2P46.