HMGB1P1 (high mobility group box 1 pseudogene 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 10357
Gene name High mobility group box 1 pseudogene 1
Gene symbol HMGB1P1
Synonyms (NCBI Gene)
HMG1L1HMG1L7HMGB1L1dJ579F20.1
Chromosome 20
Chromosome location 20q13.31
Summary This gene may represent an evolving retropseudogene of the high-mobility group box 1 gene, which has multiple pseudogenes. This gene has an intact open reading frame, where the length of encoded protein is conserved, compared to the high-mobility group bo
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 4993 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
B2RPK0
Protein name High mobility group protein B1-like 1 (High mobility group protein 1-like 1) (HMG-1L1)
Protein function Binds preferentially single-stranded DNA and unwinds double-stranded DNA.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00505 HMG_box 95 → 163 HMG (high mobility group) box Domain
PF09011 HMG_box_2 6 → 78 HMG-box domain Domain
Sequence 
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHSDASVNFSEFSNKCSERWKTMSAKEKGKF
EDMAKADKTHYERQMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYHPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPGEKKAAKLKEKYEKDIAAYQAKGKPEAAKKGVVKAEK
SKKKKEEEEDEEDEEDEEEEDEEDEEDDDDE
Sequence length 211
Interactions View interactions

No strongly related genes found yet for HMGB1P1.

No additional diseases found yet through genes similar to HMGB1P1.