Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	3159
Gene name	High mobility group AT-hook 1
Gene symbol	HMGA1
Synonyms (NCBI Gene)	HMG-RHMGA1AHMGIY
Chromosome	6
Chromosome location	6p21.31
Summary	This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove o

724

Show/Hide all (724)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000349	hsa-miR-125b-5p	Luciferase reporter assay	17563749
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assay	17563749
MIRT003152	hsa-let-7a-5p	Luciferase reporter assayqRT-PCR	19179606
MIRT003152	hsa-let-7a-5p	Luciferase reporter assayqRT-PCR	19179606
MIRT001625	hsa-let-7b-5p	pSILAC	18668040
MIRT000270	hsa-miR-16-5p	Luciferase reporter assayqRT-PCRWestern blot	19250063
MIRT000270	hsa-miR-16-5p	Luciferase reporter assayqRT-PCRWestern blot	19250063
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assayWestern blot	22245693
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assayWestern blot	22245693
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assayWestern blot	22245693
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assayWestern blot	22245693
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assayWestern blot	22245693
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assayWestern blot	22245693
MIRT006562	hsa-miR-124-3p	FlowImmunohistochemistryImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22249617
MIRT006801	hsa-miR-15a-5p	Luciferase reporter assayqRT-PCRWestern blot	22139073
MIRT000270	hsa-miR-16-5p	Luciferase reporter assayqRT-PCRWestern blot	22139073
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assayqRT-PCRWestern blot	22139073
MIRT006802	hsa-miR-196a-5p	Luciferase reporter assayqRT-PCRWestern blot	22139073
MIRT003152	hsa-let-7a-5p	Luciferase reporter assayqRT-PCRWestern blot	22139073
MIRT018872	hsa-miR-335-5p	Microarray	18185580
MIRT027852	hsa-miR-98-5p	Microarray	19088304
MIRT001625	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT003152	hsa-let-7a-5p	CLASH	23622248
MIRT001625	hsa-let-7b-5p	CLASH	23622248
MIRT047920	hsa-miR-30c-5p	CLASH	23622248
MIRT046655	hsa-miR-222-3p	CLASH	23622248
MIRT043495	hsa-miR-331-3p	CLASH	23622248
MIRT042853	hsa-miR-324-3p	CLASH	23622248
MIRT040930	hsa-miR-18a-3p	CLASH	23622248
MIRT039276	hsa-miR-671-5p	CLASH	23622248
MIRT038421	hsa-miR-296-3p	CLASH	23622248
MIRT038421	hsa-miR-296-3p	CLASH	23622248
MIRT037580	hsa-miR-744-5p	CLASH	23622248
MIRT037370	hsa-miR-877-5p	CLASH	23622248
MIRT037370	hsa-miR-877-5p	CLASH	23622248
MIRT037176	hsa-miR-877-3p	CLASH	23622248
MIRT037176	hsa-miR-877-3p	CLASH	23622248
MIRT035976	hsa-miR-1301-3p	CLASH	23622248
MIRT053121	hsa-miR-142-3p	Luciferase reporter assayqRT-PCRWestern blot	24803022
MIRT001625	hsa-let-7b-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23798998
MIRT000110	hsa-miR-26a-5p	FlowImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23796420
MIRT000110	hsa-miR-26a-5p	FlowImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23796420
MIRT437482	hsa-miR-185-5p	Luciferase reporter assayqRT-PCRWestern blot	24014023
MIRT475623	hsa-miR-758-3p	HITS-CLIP	23313552
MIRT006802	hsa-miR-196a-5p	HITS-CLIP	23313552
MIRT168592	hsa-miR-196b-5p	HITS-CLIP	23313552
MIRT027852	hsa-miR-98-5p	HITS-CLIP	23313552
MIRT168608	hsa-miR-4500	HITS-CLIP	23313552
MIRT168587	hsa-let-7g-5p	HITS-CLIP	23313552
MIRT168607	hsa-miR-4458	HITS-CLIP	23313552
MIRT168588	hsa-let-7i-5p	HITS-CLIP	23313552
MIRT168582	hsa-let-7d-5p	HITS-CLIP	23313552
MIRT168581	hsa-let-7c-5p	HITS-CLIP	23313552
MIRT001625	hsa-let-7b-5p	HITS-CLIP	23313552
MIRT003152	hsa-let-7a-5p	HITS-CLIP	23313552
MIRT168583	hsa-let-7e-5p	HITS-CLIP	23313552
MIRT168584	hsa-let-7f-5p	HITS-CLIP	23313552
MIRT475621	hsa-miR-4694-3p	HITS-CLIP	23313552
MIRT475622	hsa-miR-3125	HITS-CLIP	23313552
MIRT475620	hsa-miR-3916	HITS-CLIP	23313552
MIRT475619	hsa-miR-6859-5p	HITS-CLIP	23313552
MIRT168616	hsa-miR-6847-5p	HITS-CLIP	23313552
MIRT168601	hsa-miR-4257	HITS-CLIP	23313552
MIRT475618	hsa-miR-3148	HITS-CLIP	23313552
MIRT168595	hsa-miR-520a-5p	HITS-CLIP	23313552
MIRT168596	hsa-miR-525-5p	HITS-CLIP	23313552
MIRT475617	hsa-miR-3611	HITS-CLIP	23313552
MIRT657382	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT657381	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT168556	hsa-miR-4286	HITS-CLIP	23824327
MIRT037176	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT657380	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT657379	hsa-miR-5699-5p	HITS-CLIP	23824327
MIRT657378	hsa-miR-4758-3p	HITS-CLIP	23824327
MIRT657377	hsa-miR-3189-5p	HITS-CLIP	23824327
MIRT657376	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT657375	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT657374	hsa-miR-4659a-5p	HITS-CLIP	23824327
MIRT657373	hsa-miR-4659b-5p	HITS-CLIP	23824327
MIRT168540	hsa-miR-138-5p	PAR-CLIP	22012620
MIRT168574	hsa-miR-6779-3p	PAR-CLIP	22012620
MIRT168578	hsa-miR-6871-5p	PAR-CLIP	22012620
MIRT168546	hsa-miR-1184	PAR-CLIP	22012620
MIRT168580	hsa-miR-7978	PAR-CLIP	22012620
MIRT168549	hsa-miR-1233-3p	PAR-CLIP	22012620
MIRT168563	hsa-miR-4641	PAR-CLIP	22012620
MIRT168553	hsa-miR-3173-5p	PAR-CLIP	22012620
MIRT168576	hsa-miR-6799-3p	PAR-CLIP	22012620
MIRT168577	hsa-miR-6827-5p	PAR-CLIP	22012620
MIRT536825	hsa-miR-6090	PAR-CLIP	22012620
MIRT536824	hsa-miR-4300	PAR-CLIP	22012620
MIRT536823	hsa-miR-5591-5p	PAR-CLIP	22012620
MIRT536822	hsa-miR-6726-5p	PAR-CLIP	22012620
MIRT536821	hsa-miR-920	PAR-CLIP	22012620
MIRT536819	hsa-miR-3650	PAR-CLIP	22012620
MIRT475623	hsa-miR-758-3p	PAR-CLIP	23592263
MIRT006802	hsa-miR-196a-5p	PAR-CLIP	23592263
MIRT168592	hsa-miR-196b-5p	PAR-CLIP	23592263
MIRT027852	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT168608	hsa-miR-4500	PAR-CLIP	23592263
MIRT168587	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT168607	hsa-miR-4458	PAR-CLIP	23592263
MIRT168588	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT168582	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT168581	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT001625	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT003152	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT168583	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT168584	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT475622	hsa-miR-3125	PAR-CLIP	23592263
MIRT475620	hsa-miR-3916	PAR-CLIP	23592263
MIRT475619	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT168616	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT168601	hsa-miR-4257	PAR-CLIP	23592263
MIRT475618	hsa-miR-3148	PAR-CLIP	23592263
MIRT168595	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT168596	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT475617	hsa-miR-3611	PAR-CLIP	23592263
MIRT475644	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT168575	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT122816	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT475643	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT475642	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT475640	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT475641	hsa-miR-6784-3p	PAR-CLIP	23592263
MIRT475639	hsa-miR-6862-3p	PAR-CLIP	23592263
MIRT475638	hsa-miR-4419a	PAR-CLIP	23592263
MIRT475637	hsa-miR-4510	PAR-CLIP	23592263
MIRT475636	hsa-miR-6127	PAR-CLIP	23592263
MIRT475635	hsa-miR-6129	PAR-CLIP	23592263
MIRT475634	hsa-miR-6130	PAR-CLIP	23592263
MIRT475633	hsa-miR-6133	PAR-CLIP	23592263
MIRT475632	hsa-miR-6809-5p	PAR-CLIP	23592263
MIRT475631	hsa-miR-7974	PAR-CLIP	23592263
MIRT122808	hsa-miR-4675	PAR-CLIP	23592263
MIRT122811	hsa-miR-4741	PAR-CLIP	23592263
MIRT122798	hsa-miR-185-3p	PAR-CLIP	23592263
MIRT122818	hsa-miR-6846-5p	PAR-CLIP	23592263
MIRT122819	hsa-miR-6848-5p	PAR-CLIP	23592263
MIRT475630	hsa-miR-663b	PAR-CLIP	23592263
MIRT475628	hsa-miR-6824-5p	PAR-CLIP	23592263
MIRT475629	hsa-miR-6802-3p	PAR-CLIP	23592263
MIRT475627	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT475626	hsa-miR-4701-5p	PAR-CLIP	23592263
MIRT475625	hsa-miR-588	PAR-CLIP	23592263
MIRT475624	hsa-miR-7108-5p	PAR-CLIP	23592263
MIRT475623	hsa-miR-758-3p	PAR-CLIP	23592263
MIRT006802	hsa-miR-196a-5p	PAR-CLIP	23592263
MIRT168592	hsa-miR-196b-5p	PAR-CLIP	23592263
MIRT027852	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT168608	hsa-miR-4500	PAR-CLIP	23592263
MIRT168587	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT168607	hsa-miR-4458	PAR-CLIP	23592263
MIRT168588	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT168582	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT168581	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT001625	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT003152	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT168583	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT168584	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT475621	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT475622	hsa-miR-3125	PAR-CLIP	23592263
MIRT475620	hsa-miR-3916	PAR-CLIP	23592263
MIRT475619	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT168616	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT168601	hsa-miR-4257	PAR-CLIP	23592263
MIRT475618	hsa-miR-3148	PAR-CLIP	23592263
MIRT168595	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT168596	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT475617	hsa-miR-3611	PAR-CLIP	23592263
MIRT053121	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT440493	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT053121	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT006801	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT168589	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT000270	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT168591	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT440493	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT168591	hsa-miR-195-5p	Luciferase reporter assayWestern blot	27175617
MIRT168591	hsa-miR-195-5p	Luciferase reporter assayWestern blot	27175617
MIRT000110	hsa-miR-26a-5p	Western blot	27025651
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assayqRT-PCRWestern blot	25755724
MIRT003152	hsa-let-7a-5p	qRT-PCRWestern blot	25846193
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assayqRT-PCRWestern blot	28000891
MIRT536824	hsa-miR-4300	PAR-CLIP	26701625
MIRT536824	hsa-miR-4300	PAR-CLIP	26701625
MIRT536824	hsa-miR-4300	PAR-CLIP	26701625
MIRT536823	hsa-miR-5591-5p	PAR-CLIP	26701625
MIRT536823	hsa-miR-5591-5p	PAR-CLIP	26701625
MIRT536823	hsa-miR-5591-5p	PAR-CLIP	26701625
MIRT536825	hsa-miR-6090	PAR-CLIP	26701625
MIRT536825	hsa-miR-6090	PAR-CLIP	26701625
MIRT536825	hsa-miR-6090	PAR-CLIP	26701625
MIRT536822	hsa-miR-6726-5p	PAR-CLIP	26701625
MIRT536822	hsa-miR-6726-5p	PAR-CLIP	26701625
MIRT536822	hsa-miR-6726-5p	PAR-CLIP	26701625
MIRT168575	hsa-miR-6783-5p	PAR-CLIP	26701625
MIRT475628	hsa-miR-6824-5p	PAR-CLIP	26701625
MIRT168577	hsa-miR-6827-5p	PAR-CLIP	26701625
MIRT168577	hsa-miR-6827-5p	PAR-CLIP	26701625
MIRT168577	hsa-miR-6827-5p	PAR-CLIP	26701625
MIRT536821	hsa-miR-920	PAR-CLIP	26701625
MIRT536821	hsa-miR-920	PAR-CLIP	26701625
MIRT536821	hsa-miR-920	PAR-CLIP	26701625
MIRT732930	hsa-miR-328-5p	Immunohistochemistry (IHC)Immunoprecipitaion (IP)Luciferase reporter assayWestern blotting	34170494
MIRT735275	hsa-miR-221-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCR	32477928
MIRT475623	hsa-miR-758-3p	HITS-CLIP	23313552
MIRT006802	hsa-miR-196a-5p	HITS-CLIP	23313552
MIRT168592	hsa-miR-196b-5p	HITS-CLIP	23313552
MIRT027852	hsa-miR-98-5p	HITS-CLIP	23313552
MIRT168608	hsa-miR-4500	HITS-CLIP	23313552
MIRT168587	hsa-let-7g-5p	HITS-CLIP	23313552
MIRT168607	hsa-miR-4458	HITS-CLIP	23313552
MIRT168588	hsa-let-7i-5p	HITS-CLIP	23313552
MIRT168582	hsa-let-7d-5p	HITS-CLIP	23313552
MIRT168581	hsa-let-7c-5p	HITS-CLIP	23313552
MIRT001625	hsa-let-7b-5p	HITS-CLIP	23313552
MIRT003152	hsa-let-7a-5p	HITS-CLIP	23313552
MIRT168583	hsa-let-7e-5p	HITS-CLIP	23313552
MIRT168584	hsa-let-7f-5p	HITS-CLIP	23313552
MIRT475621	hsa-miR-4694-3p	HITS-CLIP	23313552
MIRT475622	hsa-miR-3125	HITS-CLIP	23313552
MIRT475620	hsa-miR-3916	HITS-CLIP	23313552
MIRT475619	hsa-miR-6859-5p	HITS-CLIP	23313552
MIRT168616	hsa-miR-6847-5p	HITS-CLIP	23313552
MIRT168601	hsa-miR-4257	HITS-CLIP	23313552
MIRT475618	hsa-miR-3148	HITS-CLIP	23313552
MIRT168595	hsa-miR-520a-5p	HITS-CLIP	23313552
MIRT168596	hsa-miR-525-5p	HITS-CLIP	23313552
MIRT475617	hsa-miR-3611	HITS-CLIP	23313552
MIRT657382	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT657381	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT168556	hsa-miR-4286	HITS-CLIP	23824327
MIRT037176	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT657380	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT657379	hsa-miR-5699-5p	HITS-CLIP	23824327
MIRT657378	hsa-miR-4758-3p	HITS-CLIP	23824327
MIRT657377	hsa-miR-3189-5p	HITS-CLIP	23824327
MIRT657376	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT657375	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT657374	hsa-miR-4659a-5p	HITS-CLIP	23824327
MIRT657373	hsa-miR-4659b-5p	HITS-CLIP	23824327
MIRT168540	hsa-miR-138-5p	PAR-CLIP	22012620
MIRT168574	hsa-miR-6779-3p	PAR-CLIP	22012620
MIRT168578	hsa-miR-6871-5p	PAR-CLIP	22012620
MIRT168546	hsa-miR-1184	PAR-CLIP	22012620
MIRT168580	hsa-miR-7978	PAR-CLIP	22012620
MIRT168549	hsa-miR-1233-3p	PAR-CLIP	22012620
MIRT168563	hsa-miR-4641	PAR-CLIP	22012620
MIRT168553	hsa-miR-3173-5p	PAR-CLIP	22012620
MIRT168576	hsa-miR-6799-3p	PAR-CLIP	22012620
MIRT168577	hsa-miR-6827-5p	PAR-CLIP	22012620
MIRT536825	hsa-miR-6090	PAR-CLIP	22012620
MIRT536824	hsa-miR-4300	PAR-CLIP	22012620
MIRT536823	hsa-miR-5591-5p	PAR-CLIP	22012620
MIRT536822	hsa-miR-6726-5p	PAR-CLIP	22012620
MIRT536821	hsa-miR-920	PAR-CLIP	22012620
MIRT536819	hsa-miR-3650	PAR-CLIP	22012620
MIRT475623	hsa-miR-758-3p	PAR-CLIP	23592263
MIRT006802	hsa-miR-196a-5p	PAR-CLIP	23592263
MIRT168592	hsa-miR-196b-5p	PAR-CLIP	23592263
MIRT027852	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT168608	hsa-miR-4500	PAR-CLIP	23592263
MIRT168587	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT168607	hsa-miR-4458	PAR-CLIP	23592263
MIRT168588	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT168582	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT168581	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT001625	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT003152	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT168583	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT168584	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT475622	hsa-miR-3125	PAR-CLIP	23592263
MIRT475620	hsa-miR-3916	PAR-CLIP	23592263
MIRT475619	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT168616	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT168601	hsa-miR-4257	PAR-CLIP	23592263
MIRT475618	hsa-miR-3148	PAR-CLIP	23592263
MIRT168595	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT168596	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT475617	hsa-miR-3611	PAR-CLIP	23592263
MIRT475644	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT168575	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT122816	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT475643	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT475642	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT475640	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT475641	hsa-miR-6784-3p	PAR-CLIP	23592263
MIRT475639	hsa-miR-6862-3p	PAR-CLIP	23592263
MIRT475638	hsa-miR-4419a	PAR-CLIP	23592263
MIRT475637	hsa-miR-4510	PAR-CLIP	23592263
MIRT475636	hsa-miR-6127	PAR-CLIP	23592263
MIRT475635	hsa-miR-6129	PAR-CLIP	23592263
MIRT475634	hsa-miR-6130	PAR-CLIP	23592263
MIRT475633	hsa-miR-6133	PAR-CLIP	23592263
MIRT475632	hsa-miR-6809-5p	PAR-CLIP	23592263
MIRT475631	hsa-miR-7974	PAR-CLIP	23592263
MIRT122808	hsa-miR-4675	PAR-CLIP	23592263
MIRT122811	hsa-miR-4741	PAR-CLIP	23592263
MIRT122798	hsa-miR-185-3p	PAR-CLIP	23592263
MIRT122818	hsa-miR-6846-5p	PAR-CLIP	23592263
MIRT122819	hsa-miR-6848-5p	PAR-CLIP	23592263
MIRT475630	hsa-miR-663b	PAR-CLIP	23592263
MIRT475628	hsa-miR-6824-5p	PAR-CLIP	23592263
MIRT475629	hsa-miR-6802-3p	PAR-CLIP	23592263
MIRT475627	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT475626	hsa-miR-4701-5p	PAR-CLIP	23592263
MIRT475625	hsa-miR-588	PAR-CLIP	23592263
MIRT475624	hsa-miR-7108-5p	PAR-CLIP	23592263
MIRT475623	hsa-miR-758-3p	PAR-CLIP	23592263
MIRT006802	hsa-miR-196a-5p	PAR-CLIP	23592263
MIRT168592	hsa-miR-196b-5p	PAR-CLIP	23592263
MIRT027852	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT168608	hsa-miR-4500	PAR-CLIP	23592263
MIRT168587	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT168607	hsa-miR-4458	PAR-CLIP	23592263
MIRT168588	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT168582	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT168581	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT001625	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT003152	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT168583	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT168584	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT475621	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT475622	hsa-miR-3125	PAR-CLIP	23592263
MIRT475620	hsa-miR-3916	PAR-CLIP	23592263
MIRT475619	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT168616	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT168601	hsa-miR-4257	PAR-CLIP	23592263
MIRT475618	hsa-miR-3148	PAR-CLIP	23592263
MIRT168595	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT168596	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT475617	hsa-miR-3611	PAR-CLIP	23592263
MIRT475626	hsa-miR-4701-5p	Luciferase reporter assayWestern blottingpSILACFlow cytometryELISA	35459188
MIRT006801	hsa-miR-15a-5p	MicroarrayqRT-PCR	35816043
MIRT1049048	hsa-let-7a	CLIP-seq
MIRT1049049	hsa-let-7b	CLIP-seq
MIRT1049050	hsa-let-7c	CLIP-seq
MIRT1049051	hsa-let-7d	CLIP-seq
MIRT1049052	hsa-let-7e	CLIP-seq
MIRT1049053	hsa-let-7f	CLIP-seq
MIRT1049054	hsa-let-7g	CLIP-seq
MIRT1049055	hsa-let-7i	CLIP-seq
MIRT1049056	hsa-miR-103a	CLIP-seq
MIRT1049057	hsa-miR-107	CLIP-seq
MIRT1049058	hsa-miR-1178	CLIP-seq
MIRT1049059	hsa-miR-1185	CLIP-seq
MIRT1049060	hsa-miR-1225-3p	CLIP-seq
MIRT1049061	hsa-miR-1252	CLIP-seq
MIRT1049062	hsa-miR-1302	CLIP-seq
MIRT1049063	hsa-miR-15a	CLIP-seq
MIRT1049064	hsa-miR-15b	CLIP-seq
MIRT1049065	hsa-miR-16	CLIP-seq
MIRT1049066	hsa-miR-1825	CLIP-seq
MIRT1049067	hsa-miR-1909	CLIP-seq
MIRT1049068	hsa-miR-195	CLIP-seq
MIRT1049069	hsa-miR-196a	CLIP-seq
MIRT1049070	hsa-miR-196b	CLIP-seq
MIRT1049071	hsa-miR-198	CLIP-seq
MIRT1049072	hsa-miR-199a-5p	CLIP-seq
MIRT1049073	hsa-miR-199b-5p	CLIP-seq
MIRT1049074	hsa-miR-214	CLIP-seq
MIRT1049075	hsa-miR-2681	CLIP-seq
MIRT1049076	hsa-miR-26a	CLIP-seq
MIRT1049077	hsa-miR-26b	CLIP-seq
MIRT1049078	hsa-miR-2861	CLIP-seq
MIRT1049079	hsa-miR-3144-5p	CLIP-seq
MIRT1049080	hsa-miR-3150b-3p	CLIP-seq
MIRT1049081	hsa-miR-3191	CLIP-seq
MIRT1049082	hsa-miR-3605-5p	CLIP-seq
MIRT1049083	hsa-miR-3612	CLIP-seq
MIRT1049084	hsa-miR-3613-3p	CLIP-seq
MIRT1049085	hsa-miR-3619-5p	CLIP-seq
MIRT1049086	hsa-miR-3622a-3p	CLIP-seq
MIRT1049087	hsa-miR-3622b-3p	CLIP-seq
MIRT1049088	hsa-miR-3665	CLIP-seq
MIRT1049089	hsa-miR-3679-5p	CLIP-seq
MIRT1049090	hsa-miR-3690	CLIP-seq
MIRT1049091	hsa-miR-3908	CLIP-seq
MIRT1049092	hsa-miR-3925-3p	CLIP-seq
MIRT1049093	hsa-miR-3934	CLIP-seq
MIRT1049094	hsa-miR-3937	CLIP-seq
MIRT1049095	hsa-miR-424	CLIP-seq
MIRT1049096	hsa-miR-4268	CLIP-seq
MIRT1049097	hsa-miR-4272	CLIP-seq
MIRT1049098	hsa-miR-4298	CLIP-seq
MIRT1049099	hsa-miR-4448	CLIP-seq
MIRT1049100	hsa-miR-4465	CLIP-seq
MIRT1049101	hsa-miR-4466	CLIP-seq
MIRT1049102	hsa-miR-4467	CLIP-seq
MIRT1049103	hsa-miR-4481	CLIP-seq
MIRT1049104	hsa-miR-4496	CLIP-seq
MIRT1049105	hsa-miR-4505	CLIP-seq
MIRT1049106	hsa-miR-4524	CLIP-seq
MIRT1049107	hsa-miR-4638-3p	CLIP-seq
MIRT1049108	hsa-miR-4639-3p	CLIP-seq
MIRT1049109	hsa-miR-4652-5p	CLIP-seq
MIRT1049110	hsa-miR-4668-5p	CLIP-seq
MIRT1049111	hsa-miR-4688	CLIP-seq
MIRT1049112	hsa-miR-4689	CLIP-seq
MIRT1049113	hsa-miR-4690-5p	CLIP-seq
MIRT1049114	hsa-miR-4691-5p	CLIP-seq
MIRT1049115	hsa-miR-4695-5p	CLIP-seq
MIRT1049116	hsa-miR-4745-5p	CLIP-seq
MIRT1049117	hsa-miR-4773	CLIP-seq
MIRT1049118	hsa-miR-4784	CLIP-seq
MIRT1049119	hsa-miR-491-5p	CLIP-seq
MIRT1049120	hsa-miR-497	CLIP-seq
MIRT1049121	hsa-miR-503	CLIP-seq
MIRT1049122	hsa-miR-512-5p	CLIP-seq
MIRT1049123	hsa-miR-541	CLIP-seq
MIRT1049124	hsa-miR-548a-3p	CLIP-seq
MIRT1049125	hsa-miR-548e	CLIP-seq
MIRT1049126	hsa-miR-548f	CLIP-seq
MIRT1049127	hsa-miR-619	CLIP-seq
MIRT1049128	hsa-miR-635	CLIP-seq
MIRT1049129	hsa-miR-646	CLIP-seq
MIRT1049130	hsa-miR-650	CLIP-seq
MIRT1049131	hsa-miR-654-5p	CLIP-seq
MIRT1049132	hsa-miR-675	CLIP-seq
MIRT1049133	hsa-miR-758	CLIP-seq
MIRT1049134	hsa-miR-761	CLIP-seq
MIRT1049135	hsa-miR-98	CLIP-seq
MIRT1049093	hsa-miR-3934	CLIP-seq
MIRT1049136	hsa-miR-3973	CLIP-seq
MIRT1049102	hsa-miR-4467	CLIP-seq
MIRT1049103	hsa-miR-4481	CLIP-seq
MIRT1049137	hsa-miR-4730	CLIP-seq
MIRT1049116	hsa-miR-4745-5p	CLIP-seq
MIRT1049138	hsa-miR-4758-5p	CLIP-seq
MIRT1049139	hsa-miR-939	CLIP-seq
MIRT1049060	hsa-miR-1225-3p	CLIP-seq
MIRT1920061	hsa-miR-128	CLIP-seq
MIRT1920062	hsa-miR-136	CLIP-seq
MIRT1920063	hsa-miR-1915	CLIP-seq
MIRT1920064	hsa-miR-197	CLIP-seq
MIRT1920065	hsa-miR-338-5p	CLIP-seq
MIRT1920066	hsa-miR-3616-3p	CLIP-seq
MIRT1049094	hsa-miR-3937	CLIP-seq
MIRT1920067	hsa-miR-4330	CLIP-seq
MIRT1920068	hsa-miR-4726-3p	CLIP-seq
MIRT1920069	hsa-miR-510	CLIP-seq
MIRT1049122	hsa-miR-512-5p	CLIP-seq
MIRT1920070	hsa-miR-658	CLIP-seq
MIRT1920115	hsa-miR-1233	CLIP-seq
MIRT1920062	hsa-miR-136	CLIP-seq
MIRT1920116	hsa-miR-138	CLIP-seq
MIRT1920063	hsa-miR-1915	CLIP-seq
MIRT1920064	hsa-miR-197	CLIP-seq
MIRT1920065	hsa-miR-338-5p	CLIP-seq
MIRT1049094	hsa-miR-3937	CLIP-seq
MIRT1920067	hsa-miR-4330	CLIP-seq
MIRT1049110	hsa-miR-4668-5p	CLIP-seq
MIRT1920068	hsa-miR-4726-3p	CLIP-seq
MIRT1920069	hsa-miR-510	CLIP-seq
MIRT1049122	hsa-miR-512-5p	CLIP-seq
MIRT1049124	hsa-miR-548a-3p	CLIP-seq
MIRT1049125	hsa-miR-548e	CLIP-seq
MIRT1049126	hsa-miR-548f	CLIP-seq
MIRT1049056	hsa-miR-103a	CLIP-seq
MIRT1049057	hsa-miR-107	CLIP-seq
MIRT1049058	hsa-miR-1178	CLIP-seq
MIRT1049059	hsa-miR-1185	CLIP-seq
MIRT1049060	hsa-miR-1225-3p	CLIP-seq
MIRT1920115	hsa-miR-1233	CLIP-seq
MIRT2011183	hsa-miR-1236	CLIP-seq
MIRT1049061	hsa-miR-1252	CLIP-seq
MIRT2011184	hsa-miR-1275	CLIP-seq
MIRT1920116	hsa-miR-138	CLIP-seq
MIRT1049063	hsa-miR-15a	CLIP-seq
MIRT1049064	hsa-miR-15b	CLIP-seq
MIRT1049065	hsa-miR-16	CLIP-seq
MIRT1049066	hsa-miR-1825	CLIP-seq
MIRT1049068	hsa-miR-195	CLIP-seq
MIRT1049071	hsa-miR-198	CLIP-seq
MIRT1049072	hsa-miR-199a-5p	CLIP-seq
MIRT1049073	hsa-miR-199b-5p	CLIP-seq
MIRT2011185	hsa-miR-2110	CLIP-seq
MIRT1049078	hsa-miR-2861	CLIP-seq
MIRT1049080	hsa-miR-3150b-3p	CLIP-seq
MIRT2011186	hsa-miR-3179	CLIP-seq
MIRT2011187	hsa-miR-3180	CLIP-seq
MIRT2011188	hsa-miR-3180-3p	CLIP-seq
MIRT2011189	hsa-miR-3190	CLIP-seq
MIRT2011190	hsa-miR-3196	CLIP-seq
MIRT2011191	hsa-miR-3199	CLIP-seq
MIRT2011192	hsa-miR-3202	CLIP-seq
MIRT2011193	hsa-miR-320a	CLIP-seq
MIRT2011194	hsa-miR-320b	CLIP-seq
MIRT2011195	hsa-miR-320c	CLIP-seq
MIRT2011196	hsa-miR-320d	CLIP-seq
MIRT2011197	hsa-miR-323-5p	CLIP-seq
MIRT1049082	hsa-miR-3605-5p	CLIP-seq
MIRT1049083	hsa-miR-3612	CLIP-seq
MIRT2011198	hsa-miR-3614-3p	CLIP-seq
MIRT1920066	hsa-miR-3616-3p	CLIP-seq
MIRT2011199	hsa-miR-3677-3p	CLIP-seq
MIRT1049089	hsa-miR-3679-5p	CLIP-seq
MIRT2011200	hsa-miR-3689d	CLIP-seq
MIRT1049091	hsa-miR-3908	CLIP-seq
MIRT2011201	hsa-miR-3918	CLIP-seq
MIRT1049092	hsa-miR-3925-3p	CLIP-seq
MIRT2011202	hsa-miR-3936	CLIP-seq
MIRT1049094	hsa-miR-3937	CLIP-seq
MIRT1049095	hsa-miR-424	CLIP-seq
MIRT2011203	hsa-miR-4253	CLIP-seq
MIRT1049096	hsa-miR-4268	CLIP-seq
MIRT2011204	hsa-miR-4271	CLIP-seq
MIRT2011205	hsa-miR-4292	CLIP-seq
MIRT2011206	hsa-miR-4308	CLIP-seq
MIRT2011207	hsa-miR-4312	CLIP-seq
MIRT2011208	hsa-miR-4313	CLIP-seq
MIRT2011209	hsa-miR-4426	CLIP-seq
MIRT2011210	hsa-miR-4429	CLIP-seq
MIRT2011211	hsa-miR-4447	CLIP-seq
MIRT1049099	hsa-miR-4448	CLIP-seq
MIRT1049102	hsa-miR-4467	CLIP-seq
MIRT2011212	hsa-miR-4472	CLIP-seq
MIRT2011213	hsa-miR-4477b	CLIP-seq
MIRT2011214	hsa-miR-4488	CLIP-seq
MIRT1049104	hsa-miR-4496	CLIP-seq
MIRT1049105	hsa-miR-4505	CLIP-seq
MIRT2011215	hsa-miR-4515	CLIP-seq
MIRT1049106	hsa-miR-4524	CLIP-seq
MIRT2011216	hsa-miR-4525	CLIP-seq
MIRT1049108	hsa-miR-4639-3p	CLIP-seq
MIRT2011217	hsa-miR-4647	CLIP-seq
MIRT2011218	hsa-miR-4651	CLIP-seq
MIRT2011219	hsa-miR-4654	CLIP-seq
MIRT2011220	hsa-miR-4662b	CLIP-seq
MIRT2011221	hsa-miR-4665-5p	CLIP-seq
MIRT2011222	hsa-miR-4667-5p	CLIP-seq
MIRT1049111	hsa-miR-4688	CLIP-seq
MIRT1049112	hsa-miR-4689	CLIP-seq
MIRT1049113	hsa-miR-4690-5p	CLIP-seq
MIRT1049114	hsa-miR-4691-5p	CLIP-seq
MIRT1049115	hsa-miR-4695-5p	CLIP-seq
MIRT2011223	hsa-miR-4697-5p	CLIP-seq
MIRT2011224	hsa-miR-4700-5p	CLIP-seq
MIRT2011225	hsa-miR-4710	CLIP-seq
MIRT2011226	hsa-miR-4716-3p	CLIP-seq
MIRT2011227	hsa-miR-4721	CLIP-seq
MIRT2011228	hsa-miR-4723-5p	CLIP-seq
MIRT2011229	hsa-miR-4725-3p	CLIP-seq
MIRT2011230	hsa-miR-4747-5p	CLIP-seq
MIRT2011231	hsa-miR-4761-3p	CLIP-seq
MIRT2011232	hsa-miR-4763-5p	CLIP-seq
MIRT2011233	hsa-miR-4769-3p	CLIP-seq
MIRT2011234	hsa-miR-4769-5p	CLIP-seq
MIRT1049117	hsa-miR-4773	CLIP-seq
MIRT1049118	hsa-miR-4784	CLIP-seq
MIRT2011235	hsa-miR-4792	CLIP-seq
MIRT1049120	hsa-miR-497	CLIP-seq
MIRT1049121	hsa-miR-503	CLIP-seq
MIRT1049123	hsa-miR-541	CLIP-seq
MIRT2011236	hsa-miR-552	CLIP-seq
MIRT2011237	hsa-miR-584	CLIP-seq
MIRT2011238	hsa-miR-596	CLIP-seq
MIRT2011239	hsa-miR-608	CLIP-seq
MIRT2011240	hsa-miR-625	CLIP-seq
MIRT1049128	hsa-miR-635	CLIP-seq
MIRT1049129	hsa-miR-646	CLIP-seq
MIRT2011241	hsa-miR-648	CLIP-seq
MIRT1049130	hsa-miR-650	CLIP-seq
MIRT1049131	hsa-miR-654-5p	CLIP-seq
MIRT2011242	hsa-miR-661	CLIP-seq
MIRT2011243	hsa-miR-665	CLIP-seq
MIRT2011244	hsa-miR-670	CLIP-seq
MIRT2011245	hsa-miR-7	CLIP-seq
MIRT2011246	hsa-miR-876-3p	CLIP-seq
MIRT1049048	hsa-let-7a	CLIP-seq
MIRT1049049	hsa-let-7b	CLIP-seq
MIRT1049050	hsa-let-7c	CLIP-seq
MIRT1049051	hsa-let-7d	CLIP-seq
MIRT1049052	hsa-let-7e	CLIP-seq
MIRT1049053	hsa-let-7f	CLIP-seq
MIRT1049054	hsa-let-7g	CLIP-seq
MIRT1049055	hsa-let-7i	CLIP-seq
MIRT1049056	hsa-miR-103a	CLIP-seq
MIRT1049057	hsa-miR-107	CLIP-seq
MIRT1049058	hsa-miR-1178	CLIP-seq
MIRT1049059	hsa-miR-1185	CLIP-seq
MIRT1049060	hsa-miR-1225-3p	CLIP-seq
MIRT1920115	hsa-miR-1233	CLIP-seq
MIRT1049061	hsa-miR-1252	CLIP-seq
MIRT2011184	hsa-miR-1275	CLIP-seq
MIRT1920061	hsa-miR-128	CLIP-seq
MIRT2243459	hsa-miR-1293	CLIP-seq
MIRT2243460	hsa-miR-1343	CLIP-seq
MIRT1920062	hsa-miR-136	CLIP-seq
MIRT1920116	hsa-miR-138	CLIP-seq
MIRT1049063	hsa-miR-15a	CLIP-seq
MIRT1049064	hsa-miR-15b	CLIP-seq
MIRT1049065	hsa-miR-16	CLIP-seq
MIRT1049066	hsa-miR-1825	CLIP-seq
MIRT2243461	hsa-miR-1908	CLIP-seq
MIRT1920063	hsa-miR-1915	CLIP-seq
MIRT1049068	hsa-miR-195	CLIP-seq
MIRT1049069	hsa-miR-196a	CLIP-seq
MIRT1049070	hsa-miR-196b	CLIP-seq
MIRT1049071	hsa-miR-198	CLIP-seq
MIRT1049072	hsa-miR-199a-5p	CLIP-seq
MIRT1049073	hsa-miR-199b-5p	CLIP-seq
MIRT2011185	hsa-miR-2110	CLIP-seq
MIRT1049076	hsa-miR-26a	CLIP-seq
MIRT1049077	hsa-miR-26b	CLIP-seq
MIRT1049078	hsa-miR-2861	CLIP-seq
MIRT2243462	hsa-miR-3065-3p	CLIP-seq
MIRT2243463	hsa-miR-3145-3p	CLIP-seq
MIRT2011186	hsa-miR-3179	CLIP-seq
MIRT2011187	hsa-miR-3180	CLIP-seq
MIRT2011188	hsa-miR-3180-3p	CLIP-seq
MIRT2011189	hsa-miR-3190	CLIP-seq
MIRT2011190	hsa-miR-3196	CLIP-seq
MIRT2011191	hsa-miR-3199	CLIP-seq
MIRT2011192	hsa-miR-3202	CLIP-seq
MIRT2011193	hsa-miR-320a	CLIP-seq
MIRT2011194	hsa-miR-320b	CLIP-seq
MIRT2011195	hsa-miR-320c	CLIP-seq
MIRT2011196	hsa-miR-320d	CLIP-seq
MIRT1049082	hsa-miR-3605-5p	CLIP-seq
MIRT1049083	hsa-miR-3612	CLIP-seq
MIRT1049084	hsa-miR-3613-3p	CLIP-seq
MIRT2011198	hsa-miR-3614-3p	CLIP-seq
MIRT1920066	hsa-miR-3616-3p	CLIP-seq
MIRT2243464	hsa-miR-3652	CLIP-seq
MIRT2011199	hsa-miR-3677-3p	CLIP-seq
MIRT1049089	hsa-miR-3679-5p	CLIP-seq
MIRT1049091	hsa-miR-3908	CLIP-seq
MIRT2011201	hsa-miR-3918	CLIP-seq
MIRT1049092	hsa-miR-3925-3p	CLIP-seq
MIRT2011202	hsa-miR-3936	CLIP-seq
MIRT1049094	hsa-miR-3937	CLIP-seq
MIRT1049095	hsa-miR-424	CLIP-seq
MIRT2011203	hsa-miR-4253	CLIP-seq
MIRT1049096	hsa-miR-4268	CLIP-seq
MIRT2011204	hsa-miR-4271	CLIP-seq
MIRT1049097	hsa-miR-4272	CLIP-seq
MIRT2011205	hsa-miR-4292	CLIP-seq
MIRT2011206	hsa-miR-4308	CLIP-seq
MIRT2011207	hsa-miR-4312	CLIP-seq
MIRT1920067	hsa-miR-4330	CLIP-seq
MIRT2011209	hsa-miR-4426	CLIP-seq
MIRT2011210	hsa-miR-4429	CLIP-seq
MIRT2243465	hsa-miR-4430	CLIP-seq
MIRT2011211	hsa-miR-4447	CLIP-seq
MIRT1049099	hsa-miR-4448	CLIP-seq
MIRT1049100	hsa-miR-4465	CLIP-seq
MIRT1049102	hsa-miR-4467	CLIP-seq
MIRT2011212	hsa-miR-4472	CLIP-seq
MIRT2243466	hsa-miR-4483	CLIP-seq
MIRT2011214	hsa-miR-4488	CLIP-seq
MIRT1049105	hsa-miR-4505	CLIP-seq
MIRT2011215	hsa-miR-4515	CLIP-seq
MIRT1049106	hsa-miR-4524	CLIP-seq
MIRT2011216	hsa-miR-4525	CLIP-seq
MIRT1049108	hsa-miR-4639-3p	CLIP-seq
MIRT2243467	hsa-miR-4640-5p	CLIP-seq
MIRT2011217	hsa-miR-4647	CLIP-seq
MIRT2011218	hsa-miR-4651	CLIP-seq
MIRT1049109	hsa-miR-4652-5p	CLIP-seq
MIRT2011219	hsa-miR-4654	CLIP-seq
MIRT2011220	hsa-miR-4662b	CLIP-seq
MIRT2011221	hsa-miR-4665-5p	CLIP-seq
MIRT2011222	hsa-miR-4667-5p	CLIP-seq
MIRT1049111	hsa-miR-4688	CLIP-seq
MIRT1049114	hsa-miR-4691-5p	CLIP-seq
MIRT1049115	hsa-miR-4695-5p	CLIP-seq
MIRT2011223	hsa-miR-4697-5p	CLIP-seq
MIRT2011224	hsa-miR-4700-5p	CLIP-seq
MIRT2011228	hsa-miR-4723-5p	CLIP-seq
MIRT2011229	hsa-miR-4725-3p	CLIP-seq
MIRT1920068	hsa-miR-4726-3p	CLIP-seq
MIRT2243468	hsa-miR-4726-5p	CLIP-seq
MIRT2243469	hsa-miR-4728-5p	CLIP-seq
MIRT2243470	hsa-miR-4731-5p	CLIP-seq
MIRT2011230	hsa-miR-4747-5p	CLIP-seq
MIRT2011231	hsa-miR-4761-3p	CLIP-seq
MIRT2011234	hsa-miR-4769-5p	CLIP-seq
MIRT1049117	hsa-miR-4773	CLIP-seq
MIRT2243471	hsa-miR-4786-3p	CLIP-seq
MIRT2011235	hsa-miR-4792	CLIP-seq
MIRT1049120	hsa-miR-497	CLIP-seq
MIRT1049121	hsa-miR-503	CLIP-seq
MIRT1920069	hsa-miR-510	CLIP-seq
MIRT1049122	hsa-miR-512-5p	CLIP-seq
MIRT1049123	hsa-miR-541	CLIP-seq
MIRT2011236	hsa-miR-552	CLIP-seq
MIRT2011238	hsa-miR-596	CLIP-seq
MIRT2011239	hsa-miR-608	CLIP-seq
MIRT2011240	hsa-miR-625	CLIP-seq
MIRT1049128	hsa-miR-635	CLIP-seq
MIRT2243472	hsa-miR-637	CLIP-seq
MIRT2243473	hsa-miR-638	CLIP-seq
MIRT1049129	hsa-miR-646	CLIP-seq
MIRT2011241	hsa-miR-648	CLIP-seq
MIRT1049130	hsa-miR-650	CLIP-seq
MIRT1049131	hsa-miR-654-5p	CLIP-seq
MIRT1920070	hsa-miR-658	CLIP-seq
MIRT2011242	hsa-miR-661	CLIP-seq
MIRT2243474	hsa-miR-663	CLIP-seq
MIRT2011243	hsa-miR-665	CLIP-seq
MIRT2011244	hsa-miR-670	CLIP-seq
MIRT2011245	hsa-miR-7	CLIP-seq
MIRT1049133	hsa-miR-758	CLIP-seq
MIRT1049135	hsa-miR-98	CLIP-seq
MIRT1049060	hsa-miR-1225-3p	CLIP-seq
MIRT2011184	hsa-miR-1275	CLIP-seq
MIRT1049071	hsa-miR-198	CLIP-seq
MIRT1049099	hsa-miR-4448	CLIP-seq
MIRT2011221	hsa-miR-4665-5p	CLIP-seq
MIRT2011228	hsa-miR-4723-5p	CLIP-seq
MIRT1049117	hsa-miR-4773	CLIP-seq
MIRT1049071	hsa-miR-198	CLIP-seq
MIRT1049066	hsa-miR-1825	CLIP-seq
MIRT1049072	hsa-miR-199a-5p	CLIP-seq
MIRT1049073	hsa-miR-199b-5p	CLIP-seq
MIRT1049080	hsa-miR-3150b-3p	CLIP-seq
MIRT1049092	hsa-miR-3925-3p	CLIP-seq
MIRT1049096	hsa-miR-4268	CLIP-seq
MIRT1049099	hsa-miR-4448	CLIP-seq
MIRT1049112	hsa-miR-4689	CLIP-seq
MIRT1049114	hsa-miR-4691-5p	CLIP-seq
MIRT1049118	hsa-miR-4784	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
E2F1	Activation	22389255
MYCN	Unknown	16166307
SP1	Activation	17510387
SP1	Unknown	22389255

Show/Hide all (56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	9253416
GO:0001221	Function	Transcription coregulator binding	IDA	10428834
GO:0003677	Function	DNA binding	EXP	9253416, 22615915
GO:0003677	Function	DNA binding	IDA	11069991, 15213251
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	10871404
GO:0003680	Function	Minor groove of adenine-thymine-rich DNA binding	IBA
GO:0003680	Function	Minor groove of adenine-thymine-rich DNA binding	IDA	9253416
GO:0003680	Function	Minor groove of adenine-thymine-rich DNA binding	ISS
GO:0003680	Function	Minor groove of adenine-thymine-rich DNA binding	TAS	2505228, 10428834
GO:0003682	Function	Chromatin binding	ISS
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003713	Function	Transcription coactivator activity	EXP	9253416
GO:0003713	Function	Transcription coactivator activity	IMP	10428834
GO:0003713	Function	Transcription coactivator activity	ISS
GO:0003723	Function	RNA binding	IPI	21087998
GO:0003906	Function	DNA-(apurinic or apyrimidinic site) endonuclease activity	IDA	19465398
GO:0005515	Function	Protein binding	IPI	9809067, 10400641, 10428834, 16293633, 18234858, 30021884, 33961781, 35271311
GO:0005634	Component	Nucleus	HDA	16791210
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16901784
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	TAS	10428834
GO:0005694	Component	Chromosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006284	Process	Base-excision repair	IDA	19465398
GO:0006337	Process	Nucleosome disassembly	TAS	10428834
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	10871404
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	16901784
GO:0008301	Function	DNA binding, bending	EXP	22615915
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0019899	Function	Enzyme binding	IPI	16157300
GO:0030527	Function	Structural constituent of chromatin	TAS	19389484
GO:0031965	Component	Nuclear membrane	IDA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035985	Component	Senescence-associated heterochromatin focus	IDA	16901784
GO:0042974	Function	Nuclear retinoic acid receptor binding	IDA	10428834
GO:0042975	Function	Peroxisome proliferator activated receptor binding	IDA	10428834
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	16901784
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	10428834
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046965	Function	Nuclear retinoid X receptor binding	IDA	10428834
GO:0051575	Function	5'-deoxyribose-5-phosphate lyase activity	IDA	19465398
GO:0060090	Function	Molecular adaptor activity	IDA	11069991
GO:0090402	Process	Oncogene-induced cell senescence	IDA	16901784
GO:0090575	Component	RNA polymerase II transcription regulator complex	ISS
GO:0140677	Function	Molecular function activator activity	IMP	21087998

MIM	HGNC	e!Ensembl
600701	5010	ENSG00000137309

P17096

Protein name

High mobility group protein HMG-I/HMG-Y (HMG-I(Y)) (High mobility group AT-hook protein 1) (High mobility group protein A1) (High mobility group protein R)

Protein function

HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double-stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the

PDB

2EZD , 2EZE , 2EZF , 2EZG , 8CPG

Family and domains

Sequence

MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGR
PKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ

Sequence length

107

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes mellitus type 2, susceptibility to	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEIOMYOSARCOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME X	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	CTD, ClinVar, GWAS catalog CTD, ClinVar, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (220)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	12807722, 17342093, 18316571, 18473350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17178855, 18316571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27025651, 28000891, 29512693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	17114012, 17178855, 17342093, 18316571, 18473350, 22898640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	30999005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	22961697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22249617, 26009886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17903177, 20194618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	25483074		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30228296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25904137, 27839822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	15138557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25904137, 27839822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	10347561, 11672774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	27175617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23796420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	27486901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	31116627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	19896837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast cancer, lobular	Breast Cancer	BEFREE	25572132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12002338, 12973668, 15350136, 16707431, 17290307, 19896837, 20530667, 23545254, 23658826, 23945276, 25572132, 25755724, 25772486, 25846193, 26251519 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17290307, 22932725, 23658826, 25572132, 25755724, 26265440, 26527623, 27723831, 28924209, 31167352, 31531802, 35504904, 36614035	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	12002338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18670638, 23658826, 24696416, 26537313, 27855356, 36087034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35805937	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12640109, 15272314, 15378028, 17210682, 17935122, 18202751, 19896837, 26009897, 27001612, 27855356, 29266325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	31096664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15247513, 29152644, 39591457	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27831650, 27855356, 35485281, 36635290, 36705364, 38368811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	19903768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23796420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19903768, 22363436, 24564251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	37817210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	19820691	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24564251	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	29374701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	27001612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12807722, 30816441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	27001612		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18670638, 29789601, 31043793		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	18670638, 29789601, 31043793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22249617, 26009886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28467612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29581847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17510387, 22276142, 22961697, 24833610, 25409711, 27486901, 28358427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	24833610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20473941, 23201162, 23835740, 27537384, 28452345, 29023799, 30776481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17510387, 20473941, 24696416, 24833610, 27537384, 32989212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	11672774, 26708416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	28467612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22503056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	25904137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	25904137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	25904137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15924147, 23302499, 30034366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15924147, 23302499, 29634420, 30034366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24367622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15924147, 20975707, 21364139, 22210315, 22411136, 23302499, 23512162, 24148075, 26296198, 26717491, 26980699, 27839822, 29634420, 30034366		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	23512162		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	26717491, 27991577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	25572132, 26251519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	19896837, 26251519		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	31096664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35130798, 39326337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	20461755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	20461755, 22221703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	9407002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27027341	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastro-enteropancreatic neuroendocrine tumor	Digestive system neuroendocrine neoplasm	BEFREE	19156147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15138557, 21300033, 21984063, 26092597, 26898758, 27486901, 31116627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31116627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21300033, 21984063, 26092597, 26898758, 27486901, 31116627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21300033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34887392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gliosarcoma	Gliosarcoma	Pubtator	35381788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	9290959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	26708416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	22106824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	35137191	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	35137191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	35137191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	25755724, 31531802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	35805937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	24391984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	CTD_human_DG	23512162		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	15009634	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27045138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	23545254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22210315	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35409356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	26244988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal Polyposis	BEFREE	22276142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	19903768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	23394223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	22682624, 26708416, 31851934, 35822448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	9060829	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	17483309		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leiomyosarcoma	Leiomyosarcoma	CTD_human_DG	18645019		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leiomyosarcoma, Epithelioid	Leiomyosarcoma	CTD_human_DG	18645019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma, Myxoid	Leiomyosarcoma	CTD_human_DG	18645019		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12573034		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	19074878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	10744071, 15755872, 9212729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	19963137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	19963137		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	29980789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	29980789, 9212729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	29980789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15247513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16187170, 27855356, 29152644, 31340839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	19903768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19903768, 35805937	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22363436, 24564251, 27602961, 36087034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29789601	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	19074878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	23229232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	26589882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	8761372	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	21984063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12002338, 12973668, 15350136, 16707431, 23545254, 23658826, 23945276, 25572132, 25755724, 25772486, 25846193, 26527623, 28924209, 29113200, 29316384 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	27855356, 29511732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19903768, 22363436, 24564251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12807722, 30816441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15272314, 17114012, 17178855, 17342093, 18473350, 22898640, 28697176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21138859, 22213442, 23798998, 24837491, 26084422, 27175617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31229266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	10714095, 16540646, 28393241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23796420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12807722, 15150086, 15923078, 17178855, 17290307, 17342093, 17510387, 17510394, 19074878, 19956671, 20068164, 20459557, 21336378, 21656127, 21984063 View all (37 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	16056249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	18670638, 29789601, 31043793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17510387, 22276142, 22961697, 24833610, 27486901, 28358427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12002338, 15350136, 15569996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23945276, 25572132, 31531802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	22249617, 26009886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	26009886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	24367622	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	23512162, 30034366		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	CTD_human_DG	23512162		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Diseases	Mitochondrial disease	Pubtator	22932725	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	34831413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	16364769		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	16364769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	16364769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	27839822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	30021353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	29980789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	37710236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	20530413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10347561, 10526529, 10862029, 11672774, 11848476, 12573034, 12653562, 12807722, 12973668, 15138557, 16166307, 16540646, 17178855, 17483309, 17654722 View all (42 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	11076660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15923078, 16166307, 28003484, 29321317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	17903177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	17903177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	19156147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	16056249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21656127, 24564251, 25344216, 28290473, 29512693, 30666160, 31814893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	26603474, 35459188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	33750458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	30056508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21573994, 24803022, 29928320, 30008826, 30755810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32572906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	12807722, 30816441		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15378028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32127525, 36776216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15272314, 17114012, 17178855, 17342093, 18473350, 22898640, 28697176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17342093, 19820691, 25409711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	18670638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	19223528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	28255749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	17308084, 23311322, 24828041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	16364769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	27991577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21138859, 22213442, 23798998, 24837491, 27175617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21138859, 24837491, 8761372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	22503056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	31582725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	26717491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	26657872, 27750399, 28255749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	16056249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20347905		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20347905		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seminoma	Seminoma	BEFREE	22392906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29975792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	29374701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29374701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	29374701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	19903768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Splenic Diseases	Splenic disease	Pubtator	26708416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	12640109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25245141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27882471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31229266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	39293524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26537313	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31115003, 32329839, 35014092, 35049679, 35948739, 37415737, 39293524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	16056249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	17935122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	10714095, 16540646, 25483074, 28393241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	25409711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	10714095, 31582725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	10714095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	10714095, 16540646, 22389255, 28393241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	10714095, 28393241, 35546566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	10714095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tomaculous neuropathy	Hereditary neuropathy with liability to pressure palsies	Pubtator	35805937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23658826, 25772486, 30135148, 31300541, 31311575, 31382504, 31779212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28474731, 31300541, 33835503, 35504904, 36614035	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23796420, 31196036, 33649788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	17483309, 27001612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	CTD_human_DG	18645019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18670638, 29789601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	10744071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	10526529, 21156240, 9824199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Endometrial Neoplasms	BEFREE	17483309		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Neoplasms	Endometrial Neoplasms	CTD_human_DG	18645019		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal melanoma	Pubtator	23935884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29634420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	40443672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HMGA1 (high mobility group AT-hook 1)