HMGA1 (high mobility group AT-hook 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3159
• Gene name: High mobility group AT-hook 1
• Gene symbol: HMGA1
• Synonyms (NCBI Gene): HMG-R, HMGA1A, HMGIY
• Chromosome: 6
• Chromosome location: 6p21.31
• Summary: This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove o

miRNA Show/Hide all (724)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000349	hsa-miR-125b-5p	Luciferase reporter assay	17563749
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assay	17563749
MIRT003152	hsa-let-7a-5p	Luciferase reporter assay, qRT-PCR	19179606
MIRT003152	hsa-let-7a-5p	Luciferase reporter assay, qRT-PCR	19179606
MIRT001625	hsa-let-7b-5p	pSILAC	18668040
MIRT000270	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	19250063
MIRT000270	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	19250063
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assay, Western blot	22245693
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assay, Western blot	22245693
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assay, Western blot	22245693
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assay, Western blot	22245693
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assay, Western blot	22245693
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assay, Western blot	22245693
MIRT006562	hsa-miR-124-3p	Flow, Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22249617
MIRT006801	hsa-miR-15a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22139073
MIRT000270	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	22139073
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22139073
MIRT006802	hsa-miR-196a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22139073
MIRT003152	hsa-let-7a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22139073
MIRT018872	hsa-miR-335-5p	Microarray	18185580
MIRT027852	hsa-miR-98-5p	Microarray	19088304
MIRT001625	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT003152	hsa-let-7a-5p	CLASH	23622248
MIRT001625	hsa-let-7b-5p	CLASH	23622248
MIRT047920	hsa-miR-30c-5p	CLASH	23622248
MIRT046655	hsa-miR-222-3p	CLASH	23622248
MIRT043495	hsa-miR-331-3p	CLASH	23622248
MIRT042853	hsa-miR-324-3p	CLASH	23622248
MIRT040930	hsa-miR-18a-3p	CLASH	23622248
MIRT039276	hsa-miR-671-5p	CLASH	23622248
MIRT038421	hsa-miR-296-3p	CLASH	23622248
MIRT038421	hsa-miR-296-3p	CLASH	23622248
MIRT037580	hsa-miR-744-5p	CLASH	23622248
MIRT037370	hsa-miR-877-5p	CLASH	23622248
MIRT037370	hsa-miR-877-5p	CLASH	23622248
MIRT037176	hsa-miR-877-3p	CLASH	23622248
MIRT037176	hsa-miR-877-3p	CLASH	23622248
MIRT035976	hsa-miR-1301-3p	CLASH	23622248
MIRT053121	hsa-miR-142-3p	Luciferase reporter assay, qRT-PCR, Western blot	24803022
MIRT001625	hsa-let-7b-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23798998
MIRT000110	hsa-miR-26a-5p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23796420
MIRT000110	hsa-miR-26a-5p	Flow, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23796420
MIRT437482	hsa-miR-185-5p	Luciferase reporter assay, qRT-PCR, Western blot	24014023
MIRT475623	hsa-miR-758-3p	HITS-CLIP	23313552
MIRT006802	hsa-miR-196a-5p	HITS-CLIP	23313552
MIRT168592	hsa-miR-196b-5p	HITS-CLIP	23313552
MIRT027852	hsa-miR-98-5p	HITS-CLIP	23313552
MIRT168608	hsa-miR-4500	HITS-CLIP	23313552
MIRT168587	hsa-let-7g-5p	HITS-CLIP	23313552
MIRT168607	hsa-miR-4458	HITS-CLIP	23313552
MIRT168588	hsa-let-7i-5p	HITS-CLIP	23313552
MIRT168582	hsa-let-7d-5p	HITS-CLIP	23313552
MIRT168581	hsa-let-7c-5p	HITS-CLIP	23313552
MIRT001625	hsa-let-7b-5p	HITS-CLIP	23313552
MIRT003152	hsa-let-7a-5p	HITS-CLIP	23313552
MIRT168583	hsa-let-7e-5p	HITS-CLIP	23313552
MIRT168584	hsa-let-7f-5p	HITS-CLIP	23313552
MIRT475621	hsa-miR-4694-3p	HITS-CLIP	23313552
MIRT475622	hsa-miR-3125	HITS-CLIP	23313552
MIRT475620	hsa-miR-3916	HITS-CLIP	23313552
MIRT475619	hsa-miR-6859-5p	HITS-CLIP	23313552
MIRT168616	hsa-miR-6847-5p	HITS-CLIP	23313552
MIRT168601	hsa-miR-4257	HITS-CLIP	23313552
MIRT475618	hsa-miR-3148	HITS-CLIP	23313552
MIRT168595	hsa-miR-520a-5p	HITS-CLIP	23313552
MIRT168596	hsa-miR-525-5p	HITS-CLIP	23313552
MIRT475617	hsa-miR-3611	HITS-CLIP	23313552
MIRT657382	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT657381	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT168556	hsa-miR-4286	HITS-CLIP	23824327
MIRT037176	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT657380	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT657379	hsa-miR-5699-5p	HITS-CLIP	23824327
MIRT657378	hsa-miR-4758-3p	HITS-CLIP	23824327
MIRT657377	hsa-miR-3189-5p	HITS-CLIP	23824327
MIRT657376	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT657375	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT657374	hsa-miR-4659a-5p	HITS-CLIP	23824327
MIRT657373	hsa-miR-4659b-5p	HITS-CLIP	23824327
MIRT168540	hsa-miR-138-5p	PAR-CLIP	22012620
MIRT168574	hsa-miR-6779-3p	PAR-CLIP	22012620
MIRT168578	hsa-miR-6871-5p	PAR-CLIP	22012620
MIRT168546	hsa-miR-1184	PAR-CLIP	22012620
MIRT168580	hsa-miR-7978	PAR-CLIP	22012620
MIRT168549	hsa-miR-1233-3p	PAR-CLIP	22012620
MIRT168563	hsa-miR-4641	PAR-CLIP	22012620
MIRT168553	hsa-miR-3173-5p	PAR-CLIP	22012620
MIRT168576	hsa-miR-6799-3p	PAR-CLIP	22012620
MIRT168577	hsa-miR-6827-5p	PAR-CLIP	22012620
MIRT536825	hsa-miR-6090	PAR-CLIP	22012620
MIRT536824	hsa-miR-4300	PAR-CLIP	22012620
MIRT536823	hsa-miR-5591-5p	PAR-CLIP	22012620
MIRT536822	hsa-miR-6726-5p	PAR-CLIP	22012620
MIRT536821	hsa-miR-920	PAR-CLIP	22012620
MIRT536819	hsa-miR-3650	PAR-CLIP	22012620
MIRT475623	hsa-miR-758-3p	PAR-CLIP	23592263
MIRT006802	hsa-miR-196a-5p	PAR-CLIP	23592263
MIRT168592	hsa-miR-196b-5p	PAR-CLIP	23592263
MIRT027852	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT168608	hsa-miR-4500	PAR-CLIP	23592263
MIRT168587	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT168607	hsa-miR-4458	PAR-CLIP	23592263
MIRT168588	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT168582	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT168581	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT001625	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT003152	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT168583	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT168584	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT475622	hsa-miR-3125	PAR-CLIP	23592263
MIRT475620	hsa-miR-3916	PAR-CLIP	23592263
MIRT475619	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT168616	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT168601	hsa-miR-4257	PAR-CLIP	23592263
MIRT475618	hsa-miR-3148	PAR-CLIP	23592263
MIRT168595	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT168596	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT475617	hsa-miR-3611	PAR-CLIP	23592263
MIRT475644	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT168575	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT122816	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT475643	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT475642	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT475640	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT475641	hsa-miR-6784-3p	PAR-CLIP	23592263
MIRT475639	hsa-miR-6862-3p	PAR-CLIP	23592263
MIRT475638	hsa-miR-4419a	PAR-CLIP	23592263
MIRT475637	hsa-miR-4510	PAR-CLIP	23592263
MIRT475636	hsa-miR-6127	PAR-CLIP	23592263
MIRT475635	hsa-miR-6129	PAR-CLIP	23592263
MIRT475634	hsa-miR-6130	PAR-CLIP	23592263
MIRT475633	hsa-miR-6133	PAR-CLIP	23592263
MIRT475632	hsa-miR-6809-5p	PAR-CLIP	23592263
MIRT475631	hsa-miR-7974	PAR-CLIP	23592263
MIRT122808	hsa-miR-4675	PAR-CLIP	23592263
MIRT122811	hsa-miR-4741	PAR-CLIP	23592263
MIRT122798	hsa-miR-185-3p	PAR-CLIP	23592263
MIRT122818	hsa-miR-6846-5p	PAR-CLIP	23592263
MIRT122819	hsa-miR-6848-5p	PAR-CLIP	23592263
MIRT475630	hsa-miR-663b	PAR-CLIP	23592263
MIRT475628	hsa-miR-6824-5p	PAR-CLIP	23592263
MIRT475629	hsa-miR-6802-3p	PAR-CLIP	23592263
MIRT475627	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT475626	hsa-miR-4701-5p	PAR-CLIP	23592263
MIRT475625	hsa-miR-588	PAR-CLIP	23592263
MIRT475624	hsa-miR-7108-5p	PAR-CLIP	23592263
MIRT475623	hsa-miR-758-3p	PAR-CLIP	23592263
MIRT006802	hsa-miR-196a-5p	PAR-CLIP	23592263
MIRT168592	hsa-miR-196b-5p	PAR-CLIP	23592263
MIRT027852	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT168608	hsa-miR-4500	PAR-CLIP	23592263
MIRT168587	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT168607	hsa-miR-4458	PAR-CLIP	23592263
MIRT168588	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT168582	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT168581	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT001625	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT003152	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT168583	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT168584	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT475621	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT475622	hsa-miR-3125	PAR-CLIP	23592263
MIRT475620	hsa-miR-3916	PAR-CLIP	23592263
MIRT475619	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT168616	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT168601	hsa-miR-4257	PAR-CLIP	23592263
MIRT475618	hsa-miR-3148	PAR-CLIP	23592263
MIRT168595	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT168596	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT475617	hsa-miR-3611	PAR-CLIP	23592263
MIRT053121	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT440493	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT053121	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT006801	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT168589	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT000270	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT168591	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT440493	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT168591	hsa-miR-195-5p	Luciferase reporter assay, Western blot	27175617
MIRT168591	hsa-miR-195-5p	Luciferase reporter assay, Western blot	27175617
MIRT000110	hsa-miR-26a-5p	Western blot	27025651
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25755724
MIRT003152	hsa-let-7a-5p	qRT-PCR, Western blot	25846193
MIRT000110	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	28000891
MIRT536824	hsa-miR-4300	PAR-CLIP	26701625
MIRT536824	hsa-miR-4300	PAR-CLIP	26701625
MIRT536824	hsa-miR-4300	PAR-CLIP	26701625
MIRT536823	hsa-miR-5591-5p	PAR-CLIP	26701625
MIRT536823	hsa-miR-5591-5p	PAR-CLIP	26701625
MIRT536823	hsa-miR-5591-5p	PAR-CLIP	26701625
MIRT536825	hsa-miR-6090	PAR-CLIP	26701625
MIRT536825	hsa-miR-6090	PAR-CLIP	26701625
MIRT536825	hsa-miR-6090	PAR-CLIP	26701625
MIRT536822	hsa-miR-6726-5p	PAR-CLIP	26701625
MIRT536822	hsa-miR-6726-5p	PAR-CLIP	26701625
MIRT536822	hsa-miR-6726-5p	PAR-CLIP	26701625
MIRT168575	hsa-miR-6783-5p	PAR-CLIP	26701625
MIRT475628	hsa-miR-6824-5p	PAR-CLIP	26701625
MIRT168577	hsa-miR-6827-5p	PAR-CLIP	26701625
MIRT168577	hsa-miR-6827-5p	PAR-CLIP	26701625
MIRT168577	hsa-miR-6827-5p	PAR-CLIP	26701625
MIRT536821	hsa-miR-920	PAR-CLIP	26701625
MIRT536821	hsa-miR-920	PAR-CLIP	26701625
MIRT536821	hsa-miR-920	PAR-CLIP	26701625
MIRT732930	hsa-miR-328-5p	Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, Western blotting	34170494
MIRT735275	hsa-miR-221-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	32477928
MIRT475623	hsa-miR-758-3p	HITS-CLIP	23313552
MIRT006802	hsa-miR-196a-5p	HITS-CLIP	23313552
MIRT168592	hsa-miR-196b-5p	HITS-CLIP	23313552
MIRT027852	hsa-miR-98-5p	HITS-CLIP	23313552
MIRT168608	hsa-miR-4500	HITS-CLIP	23313552
MIRT168587	hsa-let-7g-5p	HITS-CLIP	23313552
MIRT168607	hsa-miR-4458	HITS-CLIP	23313552
MIRT168588	hsa-let-7i-5p	HITS-CLIP	23313552
MIRT168582	hsa-let-7d-5p	HITS-CLIP	23313552
MIRT168581	hsa-let-7c-5p	HITS-CLIP	23313552
MIRT001625	hsa-let-7b-5p	HITS-CLIP	23313552
MIRT003152	hsa-let-7a-5p	HITS-CLIP	23313552
MIRT168583	hsa-let-7e-5p	HITS-CLIP	23313552
MIRT168584	hsa-let-7f-5p	HITS-CLIP	23313552
MIRT475621	hsa-miR-4694-3p	HITS-CLIP	23313552
MIRT475622	hsa-miR-3125	HITS-CLIP	23313552
MIRT475620	hsa-miR-3916	HITS-CLIP	23313552
MIRT475619	hsa-miR-6859-5p	HITS-CLIP	23313552
MIRT168616	hsa-miR-6847-5p	HITS-CLIP	23313552
MIRT168601	hsa-miR-4257	HITS-CLIP	23313552
MIRT475618	hsa-miR-3148	HITS-CLIP	23313552
MIRT168595	hsa-miR-520a-5p	HITS-CLIP	23313552
MIRT168596	hsa-miR-525-5p	HITS-CLIP	23313552
MIRT475617	hsa-miR-3611	HITS-CLIP	23313552
MIRT657382	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT657381	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT168556	hsa-miR-4286	HITS-CLIP	23824327
MIRT037176	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT657380	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT657379	hsa-miR-5699-5p	HITS-CLIP	23824327
MIRT657378	hsa-miR-4758-3p	HITS-CLIP	23824327
MIRT657377	hsa-miR-3189-5p	HITS-CLIP	23824327
MIRT657376	hsa-miR-4749-3p	HITS-CLIP	23824327
MIRT657375	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT657374	hsa-miR-4659a-5p	HITS-CLIP	23824327
MIRT657373	hsa-miR-4659b-5p	HITS-CLIP	23824327
MIRT168540	hsa-miR-138-5p	PAR-CLIP	22012620
MIRT168574	hsa-miR-6779-3p	PAR-CLIP	22012620
MIRT168578	hsa-miR-6871-5p	PAR-CLIP	22012620
MIRT168546	hsa-miR-1184	PAR-CLIP	22012620
MIRT168580	hsa-miR-7978	PAR-CLIP	22012620
MIRT168549	hsa-miR-1233-3p	PAR-CLIP	22012620
MIRT168563	hsa-miR-4641	PAR-CLIP	22012620
MIRT168553	hsa-miR-3173-5p	PAR-CLIP	22012620
MIRT168576	hsa-miR-6799-3p	PAR-CLIP	22012620
MIRT168577	hsa-miR-6827-5p	PAR-CLIP	22012620
MIRT536825	hsa-miR-6090	PAR-CLIP	22012620
MIRT536824	hsa-miR-4300	PAR-CLIP	22012620
MIRT536823	hsa-miR-5591-5p	PAR-CLIP	22012620
MIRT536822	hsa-miR-6726-5p	PAR-CLIP	22012620
MIRT536821	hsa-miR-920	PAR-CLIP	22012620
MIRT536819	hsa-miR-3650	PAR-CLIP	22012620
MIRT475623	hsa-miR-758-3p	PAR-CLIP	23592263
MIRT006802	hsa-miR-196a-5p	PAR-CLIP	23592263
MIRT168592	hsa-miR-196b-5p	PAR-CLIP	23592263
MIRT027852	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT168608	hsa-miR-4500	PAR-CLIP	23592263
MIRT168587	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT168607	hsa-miR-4458	PAR-CLIP	23592263
MIRT168588	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT168582	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT168581	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT001625	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT003152	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT168583	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT168584	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT475622	hsa-miR-3125	PAR-CLIP	23592263
MIRT475620	hsa-miR-3916	PAR-CLIP	23592263
MIRT475619	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT168616	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT168601	hsa-miR-4257	PAR-CLIP	23592263
MIRT475618	hsa-miR-3148	PAR-CLIP	23592263
MIRT168595	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT168596	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT475617	hsa-miR-3611	PAR-CLIP	23592263
MIRT475644	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT168575	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT122816	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT475643	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT475642	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT475640	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT475641	hsa-miR-6784-3p	PAR-CLIP	23592263
MIRT475639	hsa-miR-6862-3p	PAR-CLIP	23592263
MIRT475638	hsa-miR-4419a	PAR-CLIP	23592263
MIRT475637	hsa-miR-4510	PAR-CLIP	23592263
MIRT475636	hsa-miR-6127	PAR-CLIP	23592263
MIRT475635	hsa-miR-6129	PAR-CLIP	23592263
MIRT475634	hsa-miR-6130	PAR-CLIP	23592263
MIRT475633	hsa-miR-6133	PAR-CLIP	23592263
MIRT475632	hsa-miR-6809-5p	PAR-CLIP	23592263
MIRT475631	hsa-miR-7974	PAR-CLIP	23592263
MIRT122808	hsa-miR-4675	PAR-CLIP	23592263
MIRT122811	hsa-miR-4741	PAR-CLIP	23592263
MIRT122798	hsa-miR-185-3p	PAR-CLIP	23592263
MIRT122818	hsa-miR-6846-5p	PAR-CLIP	23592263
MIRT122819	hsa-miR-6848-5p	PAR-CLIP	23592263
MIRT475630	hsa-miR-663b	PAR-CLIP	23592263
MIRT475628	hsa-miR-6824-5p	PAR-CLIP	23592263
MIRT475629	hsa-miR-6802-3p	PAR-CLIP	23592263
MIRT475627	hsa-miR-4709-3p	PAR-CLIP	23592263
MIRT475626	hsa-miR-4701-5p	PAR-CLIP	23592263
MIRT475625	hsa-miR-588	PAR-CLIP	23592263
MIRT475624	hsa-miR-7108-5p	PAR-CLIP	23592263
MIRT475623	hsa-miR-758-3p	PAR-CLIP	23592263
MIRT006802	hsa-miR-196a-5p	PAR-CLIP	23592263
MIRT168592	hsa-miR-196b-5p	PAR-CLIP	23592263
MIRT027852	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT168608	hsa-miR-4500	PAR-CLIP	23592263
MIRT168587	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT168607	hsa-miR-4458	PAR-CLIP	23592263
MIRT168588	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT168582	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT168581	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT001625	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT003152	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT168583	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT168584	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT475621	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT475622	hsa-miR-3125	PAR-CLIP	23592263
MIRT475620	hsa-miR-3916	PAR-CLIP	23592263
MIRT475619	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT168616	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT168601	hsa-miR-4257	PAR-CLIP	23592263
MIRT475618	hsa-miR-3148	PAR-CLIP	23592263
MIRT168595	hsa-miR-520a-5p	PAR-CLIP	23592263
MIRT168596	hsa-miR-525-5p	PAR-CLIP	23592263
MIRT475617	hsa-miR-3611	PAR-CLIP	23592263
MIRT475626	hsa-miR-4701-5p	Luciferase reporter assay, Western blotting, pSILAC, Flow cytometry, ELISA	35459188
MIRT006801	hsa-miR-15a-5p	Microarray, qRT-PCR	35816043
MIRT1049048	hsa-let-7a	CLIP-seq
MIRT1049049	hsa-let-7b	CLIP-seq
MIRT1049050	hsa-let-7c	CLIP-seq
MIRT1049051	hsa-let-7d	CLIP-seq
MIRT1049052	hsa-let-7e	CLIP-seq
MIRT1049053	hsa-let-7f	CLIP-seq
MIRT1049054	hsa-let-7g	CLIP-seq
MIRT1049055	hsa-let-7i	CLIP-seq
MIRT1049056	hsa-miR-103a	CLIP-seq
MIRT1049057	hsa-miR-107	CLIP-seq
MIRT1049058	hsa-miR-1178	CLIP-seq
MIRT1049059	hsa-miR-1185	CLIP-seq
MIRT1049060	hsa-miR-1225-3p	CLIP-seq
MIRT1049061	hsa-miR-1252	CLIP-seq
MIRT1049062	hsa-miR-1302	CLIP-seq
MIRT1049063	hsa-miR-15a	CLIP-seq
MIRT1049064	hsa-miR-15b	CLIP-seq
MIRT1049065	hsa-miR-16	CLIP-seq
MIRT1049066	hsa-miR-1825	CLIP-seq
MIRT1049067	hsa-miR-1909	CLIP-seq
MIRT1049068	hsa-miR-195	CLIP-seq
MIRT1049069	hsa-miR-196a	CLIP-seq
MIRT1049070	hsa-miR-196b	CLIP-seq
MIRT1049071	hsa-miR-198	CLIP-seq
MIRT1049072	hsa-miR-199a-5p	CLIP-seq
MIRT1049073	hsa-miR-199b-5p	CLIP-seq
MIRT1049074	hsa-miR-214	CLIP-seq
MIRT1049075	hsa-miR-2681	CLIP-seq
MIRT1049076	hsa-miR-26a	CLIP-seq
MIRT1049077	hsa-miR-26b	CLIP-seq
MIRT1049078	hsa-miR-2861	CLIP-seq
MIRT1049079	hsa-miR-3144-5p	CLIP-seq
MIRT1049080	hsa-miR-3150b-3p	CLIP-seq
MIRT1049081	hsa-miR-3191	CLIP-seq
MIRT1049082	hsa-miR-3605-5p	CLIP-seq
MIRT1049083	hsa-miR-3612	CLIP-seq
MIRT1049084	hsa-miR-3613-3p	CLIP-seq
MIRT1049085	hsa-miR-3619-5p	CLIP-seq
MIRT1049086	hsa-miR-3622a-3p	CLIP-seq
MIRT1049087	hsa-miR-3622b-3p	CLIP-seq
MIRT1049088	hsa-miR-3665	CLIP-seq
MIRT1049089	hsa-miR-3679-5p	CLIP-seq
MIRT1049090	hsa-miR-3690	CLIP-seq
MIRT1049091	hsa-miR-3908	CLIP-seq
MIRT1049092	hsa-miR-3925-3p	CLIP-seq
MIRT1049093	hsa-miR-3934	CLIP-seq
MIRT1049094	hsa-miR-3937	CLIP-seq
MIRT1049095	hsa-miR-424	CLIP-seq
MIRT1049096	hsa-miR-4268	CLIP-seq
MIRT1049097	hsa-miR-4272	CLIP-seq
MIRT1049098	hsa-miR-4298	CLIP-seq
MIRT1049099	hsa-miR-4448	CLIP-seq
MIRT1049100	hsa-miR-4465	CLIP-seq
MIRT1049101	hsa-miR-4466	CLIP-seq
MIRT1049102	hsa-miR-4467	CLIP-seq
MIRT1049103	hsa-miR-4481	CLIP-seq
MIRT1049104	hsa-miR-4496	CLIP-seq
MIRT1049105	hsa-miR-4505	CLIP-seq
MIRT1049106	hsa-miR-4524	CLIP-seq
MIRT1049107	hsa-miR-4638-3p	CLIP-seq
MIRT1049108	hsa-miR-4639-3p	CLIP-seq
MIRT1049109	hsa-miR-4652-5p	CLIP-seq
MIRT1049110	hsa-miR-4668-5p	CLIP-seq
MIRT1049111	hsa-miR-4688	CLIP-seq
MIRT1049112	hsa-miR-4689	CLIP-seq
MIRT1049113	hsa-miR-4690-5p	CLIP-seq
MIRT1049114	hsa-miR-4691-5p	CLIP-seq
MIRT1049115	hsa-miR-4695-5p	CLIP-seq
MIRT1049116	hsa-miR-4745-5p	CLIP-seq
MIRT1049117	hsa-miR-4773	CLIP-seq
MIRT1049118	hsa-miR-4784	CLIP-seq
MIRT1049119	hsa-miR-491-5p	CLIP-seq
MIRT1049120	hsa-miR-497	CLIP-seq
MIRT1049121	hsa-miR-503	CLIP-seq
MIRT1049122	hsa-miR-512-5p	CLIP-seq
MIRT1049123	hsa-miR-541	CLIP-seq
MIRT1049124	hsa-miR-548a-3p	CLIP-seq
MIRT1049125	hsa-miR-548e	CLIP-seq
MIRT1049126	hsa-miR-548f	CLIP-seq
MIRT1049127	hsa-miR-619	CLIP-seq
MIRT1049128	hsa-miR-635	CLIP-seq
MIRT1049129	hsa-miR-646	CLIP-seq
MIRT1049130	hsa-miR-650	CLIP-seq
MIRT1049131	hsa-miR-654-5p	CLIP-seq
MIRT1049132	hsa-miR-675	CLIP-seq
MIRT1049133	hsa-miR-758	CLIP-seq
MIRT1049134	hsa-miR-761	CLIP-seq
MIRT1049135	hsa-miR-98	CLIP-seq
MIRT1049093	hsa-miR-3934	CLIP-seq
MIRT1049136	hsa-miR-3973	CLIP-seq
MIRT1049102	hsa-miR-4467	CLIP-seq
MIRT1049103	hsa-miR-4481	CLIP-seq
MIRT1049137	hsa-miR-4730	CLIP-seq
MIRT1049116	hsa-miR-4745-5p	CLIP-seq
MIRT1049138	hsa-miR-4758-5p	CLIP-seq
MIRT1049139	hsa-miR-939	CLIP-seq
MIRT1049060	hsa-miR-1225-3p	CLIP-seq
MIRT1920061	hsa-miR-128	CLIP-seq
MIRT1920062	hsa-miR-136	CLIP-seq
MIRT1920063	hsa-miR-1915	CLIP-seq
MIRT1920064	hsa-miR-197	CLIP-seq
MIRT1920065	hsa-miR-338-5p	CLIP-seq
MIRT1920066	hsa-miR-3616-3p	CLIP-seq
MIRT1049094	hsa-miR-3937	CLIP-seq
MIRT1920067	hsa-miR-4330	CLIP-seq
MIRT1920068	hsa-miR-4726-3p	CLIP-seq
MIRT1920069	hsa-miR-510	CLIP-seq
MIRT1049122	hsa-miR-512-5p	CLIP-seq
MIRT1920070	hsa-miR-658	CLIP-seq
MIRT1920115	hsa-miR-1233	CLIP-seq
MIRT1920062	hsa-miR-136	CLIP-seq
MIRT1920116	hsa-miR-138	CLIP-seq
MIRT1920063	hsa-miR-1915	CLIP-seq
MIRT1920064	hsa-miR-197	CLIP-seq
MIRT1920065	hsa-miR-338-5p	CLIP-seq
MIRT1049094	hsa-miR-3937	CLIP-seq
MIRT1920067	hsa-miR-4330	CLIP-seq
MIRT1049110	hsa-miR-4668-5p	CLIP-seq
MIRT1920068	hsa-miR-4726-3p	CLIP-seq
MIRT1920069	hsa-miR-510	CLIP-seq
MIRT1049122	hsa-miR-512-5p	CLIP-seq
MIRT1049124	hsa-miR-548a-3p	CLIP-seq
MIRT1049125	hsa-miR-548e	CLIP-seq
MIRT1049126	hsa-miR-548f	CLIP-seq
MIRT1049056	hsa-miR-103a	CLIP-seq
MIRT1049057	hsa-miR-107	CLIP-seq
MIRT1049058	hsa-miR-1178	CLIP-seq
MIRT1049059	hsa-miR-1185	CLIP-seq
MIRT1049060	hsa-miR-1225-3p	CLIP-seq
MIRT1920115	hsa-miR-1233	CLIP-seq
MIRT2011183	hsa-miR-1236	CLIP-seq
MIRT1049061	hsa-miR-1252	CLIP-seq
MIRT2011184	hsa-miR-1275	CLIP-seq
MIRT1920116	hsa-miR-138	CLIP-seq
MIRT1049063	hsa-miR-15a	CLIP-seq
MIRT1049064	hsa-miR-15b	CLIP-seq
MIRT1049065	hsa-miR-16	CLIP-seq
MIRT1049066	hsa-miR-1825	CLIP-seq
MIRT1049068	hsa-miR-195	CLIP-seq
MIRT1049071	hsa-miR-198	CLIP-seq
MIRT1049072	hsa-miR-199a-5p	CLIP-seq
MIRT1049073	hsa-miR-199b-5p	CLIP-seq
MIRT2011185	hsa-miR-2110	CLIP-seq
MIRT1049078	hsa-miR-2861	CLIP-seq
MIRT1049080	hsa-miR-3150b-3p	CLIP-seq
MIRT2011186	hsa-miR-3179	CLIP-seq
MIRT2011187	hsa-miR-3180	CLIP-seq
MIRT2011188	hsa-miR-3180-3p	CLIP-seq
MIRT2011189	hsa-miR-3190	CLIP-seq
MIRT2011190	hsa-miR-3196	CLIP-seq
MIRT2011191	hsa-miR-3199	CLIP-seq
MIRT2011192	hsa-miR-3202	CLIP-seq
MIRT2011193	hsa-miR-320a	CLIP-seq
MIRT2011194	hsa-miR-320b	CLIP-seq
MIRT2011195	hsa-miR-320c	CLIP-seq
MIRT2011196	hsa-miR-320d	CLIP-seq
MIRT2011197	hsa-miR-323-5p	CLIP-seq
MIRT1049082	hsa-miR-3605-5p	CLIP-seq
MIRT1049083	hsa-miR-3612	CLIP-seq
MIRT2011198	hsa-miR-3614-3p	CLIP-seq
MIRT1920066	hsa-miR-3616-3p	CLIP-seq
MIRT2011199	hsa-miR-3677-3p	CLIP-seq
MIRT1049089	hsa-miR-3679-5p	CLIP-seq
MIRT2011200	hsa-miR-3689d	CLIP-seq
MIRT1049091	hsa-miR-3908	CLIP-seq
MIRT2011201	hsa-miR-3918	CLIP-seq
MIRT1049092	hsa-miR-3925-3p	CLIP-seq
MIRT2011202	hsa-miR-3936	CLIP-seq
MIRT1049094	hsa-miR-3937	CLIP-seq
MIRT1049095	hsa-miR-424	CLIP-seq
MIRT2011203	hsa-miR-4253	CLIP-seq
MIRT1049096	hsa-miR-4268	CLIP-seq
MIRT2011204	hsa-miR-4271	CLIP-seq
MIRT2011205	hsa-miR-4292	CLIP-seq
MIRT2011206	hsa-miR-4308	CLIP-seq
MIRT2011207	hsa-miR-4312	CLIP-seq
MIRT2011208	hsa-miR-4313	CLIP-seq
MIRT2011209	hsa-miR-4426	CLIP-seq
MIRT2011210	hsa-miR-4429	CLIP-seq
MIRT2011211	hsa-miR-4447	CLIP-seq
MIRT1049099	hsa-miR-4448	CLIP-seq
MIRT1049102	hsa-miR-4467	CLIP-seq
MIRT2011212	hsa-miR-4472	CLIP-seq
MIRT2011213	hsa-miR-4477b	CLIP-seq
MIRT2011214	hsa-miR-4488	CLIP-seq
MIRT1049104	hsa-miR-4496	CLIP-seq
MIRT1049105	hsa-miR-4505	CLIP-seq
MIRT2011215	hsa-miR-4515	CLIP-seq
MIRT1049106	hsa-miR-4524	CLIP-seq
MIRT2011216	hsa-miR-4525	CLIP-seq
MIRT1049108	hsa-miR-4639-3p	CLIP-seq
MIRT2011217	hsa-miR-4647	CLIP-seq
MIRT2011218	hsa-miR-4651	CLIP-seq
MIRT2011219	hsa-miR-4654	CLIP-seq
MIRT2011220	hsa-miR-4662b	CLIP-seq
MIRT2011221	hsa-miR-4665-5p	CLIP-seq
MIRT2011222	hsa-miR-4667-5p	CLIP-seq
MIRT1049111	hsa-miR-4688	CLIP-seq
MIRT1049112	hsa-miR-4689	CLIP-seq
MIRT1049113	hsa-miR-4690-5p	CLIP-seq
MIRT1049114	hsa-miR-4691-5p	CLIP-seq
MIRT1049115	hsa-miR-4695-5p	CLIP-seq
MIRT2011223	hsa-miR-4697-5p	CLIP-seq
MIRT2011224	hsa-miR-4700-5p	CLIP-seq
MIRT2011225	hsa-miR-4710	CLIP-seq
MIRT2011226	hsa-miR-4716-3p	CLIP-seq
MIRT2011227	hsa-miR-4721	CLIP-seq
MIRT2011228	hsa-miR-4723-5p	CLIP-seq
MIRT2011229	hsa-miR-4725-3p	CLIP-seq
MIRT2011230	hsa-miR-4747-5p	CLIP-seq
MIRT2011231	hsa-miR-4761-3p	CLIP-seq
MIRT2011232	hsa-miR-4763-5p	CLIP-seq
MIRT2011233	hsa-miR-4769-3p	CLIP-seq
MIRT2011234	hsa-miR-4769-5p	CLIP-seq
MIRT1049117	hsa-miR-4773	CLIP-seq
MIRT1049118	hsa-miR-4784	CLIP-seq
MIRT2011235	hsa-miR-4792	CLIP-seq
MIRT1049120	hsa-miR-497	CLIP-seq
MIRT1049121	hsa-miR-503	CLIP-seq
MIRT1049123	hsa-miR-541	CLIP-seq
MIRT2011236	hsa-miR-552	CLIP-seq
MIRT2011237	hsa-miR-584	CLIP-seq
MIRT2011238	hsa-miR-596	CLIP-seq
MIRT2011239	hsa-miR-608	CLIP-seq
MIRT2011240	hsa-miR-625	CLIP-seq
MIRT1049128	hsa-miR-635	CLIP-seq
MIRT1049129	hsa-miR-646	CLIP-seq
MIRT2011241	hsa-miR-648	CLIP-seq
MIRT1049130	hsa-miR-650	CLIP-seq
MIRT1049131	hsa-miR-654-5p	CLIP-seq
MIRT2011242	hsa-miR-661	CLIP-seq
MIRT2011243	hsa-miR-665	CLIP-seq
MIRT2011244	hsa-miR-670	CLIP-seq
MIRT2011245	hsa-miR-7	CLIP-seq
MIRT2011246	hsa-miR-876-3p	CLIP-seq
MIRT1049048	hsa-let-7a	CLIP-seq
MIRT1049049	hsa-let-7b	CLIP-seq
MIRT1049050	hsa-let-7c	CLIP-seq
MIRT1049051	hsa-let-7d	CLIP-seq
MIRT1049052	hsa-let-7e	CLIP-seq
MIRT1049053	hsa-let-7f	CLIP-seq
MIRT1049054	hsa-let-7g	CLIP-seq
MIRT1049055	hsa-let-7i	CLIP-seq
MIRT1049056	hsa-miR-103a	CLIP-seq
MIRT1049057	hsa-miR-107	CLIP-seq
MIRT1049058	hsa-miR-1178	CLIP-seq
MIRT1049059	hsa-miR-1185	CLIP-seq
MIRT1049060	hsa-miR-1225-3p	CLIP-seq
MIRT1920115	hsa-miR-1233	CLIP-seq
MIRT1049061	hsa-miR-1252	CLIP-seq
MIRT2011184	hsa-miR-1275	CLIP-seq
MIRT1920061	hsa-miR-128	CLIP-seq
MIRT2243459	hsa-miR-1293	CLIP-seq
MIRT2243460	hsa-miR-1343	CLIP-seq
MIRT1920062	hsa-miR-136	CLIP-seq
MIRT1920116	hsa-miR-138	CLIP-seq
MIRT1049063	hsa-miR-15a	CLIP-seq
MIRT1049064	hsa-miR-15b	CLIP-seq
MIRT1049065	hsa-miR-16	CLIP-seq
MIRT1049066	hsa-miR-1825	CLIP-seq
MIRT2243461	hsa-miR-1908	CLIP-seq
MIRT1920063	hsa-miR-1915	CLIP-seq
MIRT1049068	hsa-miR-195	CLIP-seq
MIRT1049069	hsa-miR-196a	CLIP-seq
MIRT1049070	hsa-miR-196b	CLIP-seq
MIRT1049071	hsa-miR-198	CLIP-seq
MIRT1049072	hsa-miR-199a-5p	CLIP-seq
MIRT1049073	hsa-miR-199b-5p	CLIP-seq
MIRT2011185	hsa-miR-2110	CLIP-seq
MIRT1049076	hsa-miR-26a	CLIP-seq
MIRT1049077	hsa-miR-26b	CLIP-seq
MIRT1049078	hsa-miR-2861	CLIP-seq
MIRT2243462	hsa-miR-3065-3p	CLIP-seq
MIRT2243463	hsa-miR-3145-3p	CLIP-seq
MIRT2011186	hsa-miR-3179	CLIP-seq
MIRT2011187	hsa-miR-3180	CLIP-seq
MIRT2011188	hsa-miR-3180-3p	CLIP-seq
MIRT2011189	hsa-miR-3190	CLIP-seq
MIRT2011190	hsa-miR-3196	CLIP-seq
MIRT2011191	hsa-miR-3199	CLIP-seq
MIRT2011192	hsa-miR-3202	CLIP-seq
MIRT2011193	hsa-miR-320a	CLIP-seq
MIRT2011194	hsa-miR-320b	CLIP-seq
MIRT2011195	hsa-miR-320c	CLIP-seq
MIRT2011196	hsa-miR-320d	CLIP-seq
MIRT1049082	hsa-miR-3605-5p	CLIP-seq
MIRT1049083	hsa-miR-3612	CLIP-seq
MIRT1049084	hsa-miR-3613-3p	CLIP-seq
MIRT2011198	hsa-miR-3614-3p	CLIP-seq
MIRT1920066	hsa-miR-3616-3p	CLIP-seq
MIRT2243464	hsa-miR-3652	CLIP-seq
MIRT2011199	hsa-miR-3677-3p	CLIP-seq
MIRT1049089	hsa-miR-3679-5p	CLIP-seq
MIRT1049091	hsa-miR-3908	CLIP-seq
MIRT2011201	hsa-miR-3918	CLIP-seq
MIRT1049092	hsa-miR-3925-3p	CLIP-seq
MIRT2011202	hsa-miR-3936	CLIP-seq
MIRT1049094	hsa-miR-3937	CLIP-seq
MIRT1049095	hsa-miR-424	CLIP-seq
MIRT2011203	hsa-miR-4253	CLIP-seq
MIRT1049096	hsa-miR-4268	CLIP-seq
MIRT2011204	hsa-miR-4271	CLIP-seq
MIRT1049097	hsa-miR-4272	CLIP-seq
MIRT2011205	hsa-miR-4292	CLIP-seq
MIRT2011206	hsa-miR-4308	CLIP-seq
MIRT2011207	hsa-miR-4312	CLIP-seq
MIRT1920067	hsa-miR-4330	CLIP-seq
MIRT2011209	hsa-miR-4426	CLIP-seq
MIRT2011210	hsa-miR-4429	CLIP-seq
MIRT2243465	hsa-miR-4430	CLIP-seq
MIRT2011211	hsa-miR-4447	CLIP-seq
MIRT1049099	hsa-miR-4448	CLIP-seq
MIRT1049100	hsa-miR-4465	CLIP-seq
MIRT1049102	hsa-miR-4467	CLIP-seq
MIRT2011212	hsa-miR-4472	CLIP-seq
MIRT2243466	hsa-miR-4483	CLIP-seq
MIRT2011214	hsa-miR-4488	CLIP-seq
MIRT1049105	hsa-miR-4505	CLIP-seq
MIRT2011215	hsa-miR-4515	CLIP-seq
MIRT1049106	hsa-miR-4524	CLIP-seq
MIRT2011216	hsa-miR-4525	CLIP-seq
MIRT1049108	hsa-miR-4639-3p	CLIP-seq
MIRT2243467	hsa-miR-4640-5p	CLIP-seq
MIRT2011217	hsa-miR-4647	CLIP-seq
MIRT2011218	hsa-miR-4651	CLIP-seq
MIRT1049109	hsa-miR-4652-5p	CLIP-seq
MIRT2011219	hsa-miR-4654	CLIP-seq
MIRT2011220	hsa-miR-4662b	CLIP-seq
MIRT2011221	hsa-miR-4665-5p	CLIP-seq
MIRT2011222	hsa-miR-4667-5p	CLIP-seq
MIRT1049111	hsa-miR-4688	CLIP-seq
MIRT1049114	hsa-miR-4691-5p	CLIP-seq
MIRT1049115	hsa-miR-4695-5p	CLIP-seq
MIRT2011223	hsa-miR-4697-5p	CLIP-seq
MIRT2011224	hsa-miR-4700-5p	CLIP-seq
MIRT2011228	hsa-miR-4723-5p	CLIP-seq
MIRT2011229	hsa-miR-4725-3p	CLIP-seq
MIRT1920068	hsa-miR-4726-3p	CLIP-seq
MIRT2243468	hsa-miR-4726-5p	CLIP-seq
MIRT2243469	hsa-miR-4728-5p	CLIP-seq
MIRT2243470	hsa-miR-4731-5p	CLIP-seq
MIRT2011230	hsa-miR-4747-5p	CLIP-seq
MIRT2011231	hsa-miR-4761-3p	CLIP-seq
MIRT2011234	hsa-miR-4769-5p	CLIP-seq
MIRT1049117	hsa-miR-4773	CLIP-seq
MIRT2243471	hsa-miR-4786-3p	CLIP-seq
MIRT2011235	hsa-miR-4792	CLIP-seq
MIRT1049120	hsa-miR-497	CLIP-seq
MIRT1049121	hsa-miR-503	CLIP-seq
MIRT1920069	hsa-miR-510	CLIP-seq
MIRT1049122	hsa-miR-512-5p	CLIP-seq
MIRT1049123	hsa-miR-541	CLIP-seq
MIRT2011236	hsa-miR-552	CLIP-seq
MIRT2011238	hsa-miR-596	CLIP-seq
MIRT2011239	hsa-miR-608	CLIP-seq
MIRT2011240	hsa-miR-625	CLIP-seq
MIRT1049128	hsa-miR-635	CLIP-seq
MIRT2243472	hsa-miR-637	CLIP-seq
MIRT2243473	hsa-miR-638	CLIP-seq
MIRT1049129	hsa-miR-646	CLIP-seq
MIRT2011241	hsa-miR-648	CLIP-seq
MIRT1049130	hsa-miR-650	CLIP-seq
MIRT1049131	hsa-miR-654-5p	CLIP-seq
MIRT1920070	hsa-miR-658	CLIP-seq
MIRT2011242	hsa-miR-661	CLIP-seq
MIRT2243474	hsa-miR-663	CLIP-seq
MIRT2011243	hsa-miR-665	CLIP-seq
MIRT2011244	hsa-miR-670	CLIP-seq
MIRT2011245	hsa-miR-7	CLIP-seq
MIRT1049133	hsa-miR-758	CLIP-seq
MIRT1049135	hsa-miR-98	CLIP-seq
MIRT1049060	hsa-miR-1225-3p	CLIP-seq
MIRT2011184	hsa-miR-1275	CLIP-seq
MIRT1049071	hsa-miR-198	CLIP-seq
MIRT1049099	hsa-miR-4448	CLIP-seq
MIRT2011221	hsa-miR-4665-5p	CLIP-seq
MIRT2011228	hsa-miR-4723-5p	CLIP-seq
MIRT1049117	hsa-miR-4773	CLIP-seq
MIRT1049071	hsa-miR-198	CLIP-seq
MIRT1049066	hsa-miR-1825	CLIP-seq
MIRT1049072	hsa-miR-199a-5p	CLIP-seq
MIRT1049073	hsa-miR-199b-5p	CLIP-seq
MIRT1049080	hsa-miR-3150b-3p	CLIP-seq
MIRT1049092	hsa-miR-3925-3p	CLIP-seq
MIRT1049096	hsa-miR-4268	CLIP-seq
MIRT1049099	hsa-miR-4448	CLIP-seq
MIRT1049112	hsa-miR-4689	CLIP-seq
MIRT1049114	hsa-miR-4691-5p	CLIP-seq
MIRT1049118	hsa-miR-4784	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Activation	22389255
MYCN	Unknown	16166307
SP1	Activation	17510387
SP1	Unknown	22389255

Gene ontology (GO) Show/Hide all (56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	9253416
GO:0001221	Function	Transcription coregulator binding	IDA	10428834
GO:0003677	Function	DNA binding	EXP	9253416, 22615915
GO:0003677	Function	DNA binding	IDA	11069991, 15213251
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	10871404
GO:0003680	Function	Minor groove of adenine-thymine-rich DNA binding	IBA
GO:0003680	Function	Minor groove of adenine-thymine-rich DNA binding	IDA	9253416
GO:0003680	Function	Minor groove of adenine-thymine-rich DNA binding	ISS
GO:0003680	Function	Minor groove of adenine-thymine-rich DNA binding	TAS	2505228, 10428834
GO:0003682	Function	Chromatin binding	ISS
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003713	Function	Transcription coactivator activity	EXP	9253416
GO:0003713	Function	Transcription coactivator activity	IMP	10428834
GO:0003713	Function	Transcription coactivator activity	ISS
GO:0003723	Function	RNA binding	IPI	21087998
GO:0003906	Function	DNA-(apurinic or apyrimidinic site) endonuclease activity	IDA	19465398
GO:0005515	Function	Protein binding	IPI	9809067, 10400641, 10428834, 16293633, 18234858, 30021884, 33961781, 35271311
GO:0005634	Component	Nucleus	HDA	16791210
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16901784
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	TAS	10428834
GO:0005694	Component	Chromosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006284	Process	Base-excision repair	IDA	19465398
GO:0006337	Process	Nucleosome disassembly	TAS	10428834
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	10871404
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	16901784
GO:0008301	Function	DNA binding, bending	EXP	22615915
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0019899	Function	Enzyme binding	IPI	16157300
GO:0030527	Function	Structural constituent of chromatin	TAS	19389484
GO:0031965	Component	Nuclear membrane	IDA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035985	Component	Senescence-associated heterochromatin focus	IDA	16901784
GO:0042974	Function	Nuclear retinoic acid receptor binding	IDA	10428834
GO:0042975	Function	Peroxisome proliferator activated receptor binding	IDA	10428834
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	16901784
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	10428834
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046965	Function	Nuclear retinoid X receptor binding	IDA	10428834
GO:0051575	Function	5'-deoxyribose-5-phosphate lyase activity	IDA	19465398
GO:0060090	Function	Molecular adaptor activity	IDA	11069991
GO:0090402	Process	Oncogene-induced cell senescence	IDA	16901784
GO:0090575	Component	RNA polymerase II transcription regulator complex	ISS
GO:0140677	Function	Molecular function activator activity	IMP	21087998

Other IDs

• MIM: 600701
• HGNC: 5010
• e!Ensembl: ENSG00000137309

Protein

• UniProt ID: P17096
• Protein name: High mobility group protein HMG-I/HMG-Y (HMG-I(Y)) (High mobility group AT-hook protein 1) (High mobility group protein A1) (High mobility group protein R)
• Protein function: HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double-stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the
• PDB: 2EZD , 2EZE , 2EZF , 2EZG , 8CPG
• Sequence:

  MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGR
  PKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ

• Sequence length: 107

Pathways

Reactome Pathway

Integration of provirus

2-LTR circle formation

Integration of viral DNA into host genomic DNA

Autointegration results in viral DNA circles

APOBEC3G mediated resistance to HIV-1 infection

Vpr-mediated nuclear import of PICs

Formation of Senescence-Associated Heterochromatin Foci (SAHF)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (14)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	36653681	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes mellitus type 2, susceptibility to	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	23512162	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	23512162	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	23512162	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEIOMYOSARCOMA	—	CTD	18645019	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	CTD, GWAS catalog CTD, GWAS catalog	23512162, 39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME X	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	CTD, ClinVar, GWAS catalog CTD, ClinVar, GWAS catalog	15924147, 21364139, 38374256, 38685053, 39349817, 39379762, 40210677	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	38191017	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE NEOPLASMS	—	CTD	18645019	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (220)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	12807722, 17342093, 18316571, 18473350		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17178855, 18316571		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27025651, 28000891, 29512693		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	17114012, 17178855, 17342093, 18316571, 18473350, 22898640		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	30999005		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	22961697		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22249617, 26009886		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17903177, 20194618	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	25483074		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30228296		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

IRS2 1 shared diseaseHyperglycemia 5 shared evidence sourcesDisgenet (Diabetes mellitus type 2), CTD (Diabetes mellitus type 2), ClinVar (Diabetes mellitus type 2), CTD (Hyperglycemia), Disgenet (Hyperglycemia) Related via 1 shared disease including Hyperglycemia — evidence mostly Disgenet. PSIP1 6 shared pathwaysVpr-mediated nuclear import of PICs, Integration of provirus, 2-LTR circle formation, Integration of viral DNA into host genomic DNA, Autointegration results in viral DNA circles, APOBEC3G mediated resistance to HIV-1 infection Related via 6 shared pathways including Vpr-mediated nuclear import of PICs, Integration of provirus. BANF1 6 shared pathwaysVpr-mediated nuclear import of PICs, Integration of provirus, 2-LTR circle formation, Integration of viral DNA into host genomic DNA, Autointegration results in viral DNA circles, APOBEC3G mediated resistance to HIV-1 infection Related via 6 shared pathways including Vpr-mediated nuclear import of PICs, Integration of provirus. INPPL1 4 shared evidence sourcesDisgenet (Diabetes mellitus type 2), CTD (Diabetes mellitus type 2), Disgenet (Metabolic syndrome), CTD (Metabolic syndrome) Related via 4 shared evidence sources. MAPK8IP1 3 shared evidence sourcesDisgenet (Diabetes mellitus type 2), CTD (Diabetes mellitus type 2), ClinVar (Diabetes mellitus type 2) Related via 3 shared evidence sources.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
IRS2	1	["Hyperglycemia"]	0	[]	5	["Disgenet (Diabetes mellitus type 2)","CTD (Diabetes mellitus type 2)","ClinVar (Diabetes mellitus type 2)","CTD (Hyperglycemia)","Disgenet (Hyperglycemia)"]
PSIP1	0	[]	6	["Vpr-mediated nuclear import of PICs","Integration of provirus","2-LTR circle formation","Integration of viral DNA into host genomic DNA","Autointegration results in viral DNA circles","APOBEC3G mediated resistance to HIV-1 infection"]	0	[]
BANF1	0	[]	6	["Vpr-mediated nuclear import of PICs","Integration of provirus","2-LTR circle formation","Integration of viral DNA into host genomic DNA","Autointegration results in viral DNA circles","APOBEC3G mediated resistance to HIV-1 infection"]	0	[]
INPPL1	0	[]	0	[]	4	["Disgenet (Diabetes mellitus type 2)","CTD (Diabetes mellitus type 2)","Disgenet (Metabolic syndrome)","CTD (Metabolic syndrome)"]
MAPK8IP1	0	[]	0	[]	3	["Disgenet (Diabetes mellitus type 2)","CTD (Diabetes mellitus type 2)","ClinVar (Diabetes mellitus type 2)"]

Diseases Linked via Similar Genes

Hepatocellular carcinoma Linked via 1 of 5 related genesIRS2 Medulloblastoma Linked via 1 of 5 related genesIRS2 Parkinson disease Linked via 1 of 5 related genesIRS2 Prostate cancer Linked via 1 of 5 related genesIRS2 Stomach neoplasms Linked via 1 of 5 related genesIRS2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Hepatocellular carcinoma	1	["IRS2"]
Medulloblastoma	1	["IRS2"]
Parkinson disease	1	["IRS2"]
Prostate cancer	1	["IRS2"]
Stomach neoplasms	1	["IRS2"]